WORLDWIDE
SOLUTIONS
PLANETTE
EARTH MOTHER
IDEAS
FOR A
NEW WORLD
FEMISODE
O34O
GirlyHeartsCuddleChoices
IMTERMAMSIOM
OOOOO07
Triplettes
Twinsys
TuTuSeptuplettes
WARNING VERY SENSITIVE AND UPSETTING CONTENT IS INCLUDED IN
THIS PROJECT. PLEASE ONLY READ ON IF YOU ARE 18 YEARS OLD OR OLDER OR THE AGE YOU BECOME A
LEGAL GROWN UP IN YOUR COUNTRY OF RESIDENCE IF THAT IS OLDER THAN 18 YEARS OLD
@66
poems
mammanannasnonna’sbubbas
zzuboo
all GirlsGirlysGirlsyGirlsysGirl
@
femisodes total: 358298
glossary 39784
total written: 398082
undrafted 51506
(062) 18954 (07)12566
83026
total 481108
TO DO LIST:
OO, Put Comments Om This Femisode
PleaseyAliSnuggle
OO, m m Mammas (no just how always wamted)
OO, PictureForGlossaryTo HaveOwnBlogPage/googlephotos
OO, --words human amd masculin amd
morphographic on blog (AmdFemisodeScriptFile)
OO,CacoPhomicLimksImDescriptiomsCorrectLimk(somedonenot
earliervids)
OO, check new audionotes. i have partially rewritten the info on frank herbert prior to a proper re edit that is to follow that is to show the actual truth rather than the so called mens falsified filthings that frank and others wanted to present to the so called world. other changes might apply to other text too.
DRAFT AMB DRESS AMB POEMS
Agnieszka
“Purifying Innocence” LovePure PerfectiomElla
Sylwia “Love Of
The Forest” ComfortingForestMist
Keanu “CoolBreeze
Over The Mountains” Refreshing Longevity
Charles
“FreelyAdored” GirlyBeLoved GirlyNestLoved
💖💖💖💖
OOO--1O1—OOO
we are surrounded by
girls bubbagirlynest everywhere : bubbagirlslove
We Are Surrounded By
Zeros, Zeros EveryWhere, Zero Isnt Just The Middle Point Of All Numbers, The
Centre The Heart, The Love, The SuPramLove, Zero Is EveryNumber........Bigger TumbubbaTumbubba Feelingsy
Is GirlyismisticElla, As To
Justly Think Each Number Is OneEvery Is To KissAmpleKissLove The EveryEvery Um
GirlyKissesMateriElle........The
ForeverLove💖💖TheForeverLoveCircle
EveryEvery Is
CemtrAll: EveryEvery Is CemtrAli:
The ForeverLoveCircle Is Xero........A Love 2
FemininiEqualityBoo........Xero Kisses TheEqual MiddleWith💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖Her AmInfinite ImterKissingNest Where AmImfiniteAmoumt
OfDifferemt ProgressiomFashiomedCaroLinesKissAtOmeSnuggleLoveGirlyDuoPeriod(s).
This Is TheFussyestFussyFussyFussFussNestOfGirlyYumYumLoveLesboSisterSnuggleAliCarolineKissyed
Timebubba: ThisIsTheSolidityGirlySphereOfLoveNestLove OfAnEqualityMeasuredLoveNest
AMbe AllOfImfinityAsAPregMamsyGrowyTumbTumbTumbubbaTumbubbaBiggestBosomAliCaroLine’sKissySnuggleBuggleBoo
AMbe
AllOfInfinityAsAWeHaveLovedForEverImInfiniteGirlyWorldsOfKissSistermceAlwaysAMbeForEverNestingSinceThem:AreForEverGirlyLoveNestLoveNeverBeginningNeverEnding
AMbe
AllOfUmFinitySumThatDoNotEndAMbeOthersThatDOOFormuLactateEveryEveryFutureUmKissesChildLoveASeaOfForeverGirlyDuoPeriodsGirlyMammaRealityRealisedUsThatSheIsUsmAMbeWeAreEveryEveryAsAliKissySnuggleCarolineBeloved.
Xero Surrounds All Numbers (AMbe Is Her CuddlyKissyHeartsyCentreSnuggleKissyCarolineAli)
Xero Is. Xero Is Is. Zero Is The CentreSnuggle Anchor Of All
KissSistermce........The BiVine Feminine FidelityTruth........BiVinity Is
Fidelity(........)BiVinity Is FidelityKiss........Zero Is The ForeverLoveTwinsyBubbaLover.
Any Given Volume Of KissSistermce Is NumericElly DesigMaterAble And
This Finity Is Surrounded By A Sea Of NumericElle Zeros
Im Number MetaphoricElle, AMbe These Zeros
Are To Be Of The Representatiom Of EveryEvery
That Volume Is Not........So everyevery Is
Zeros Im Value everyeverybubbalovefambilyAttributiomEllabubbatheory.
All Mater Of Infinity Can Be Thought Of As
Xero RePreseMatiomElle For
That Which We FeelingsyThoughtsyKiss Upom Is Cuddled By The AllGirl Of Kiss As Xero, AMbe Whem We Decide Allxero Cam Shift From Kiss Metaphoric To RePreSeeMaternIve
Bubble As Of An Infinite InNannaLove PotentiElle With Seas Of Neverending Xeros Down Into An InternElle Infinite Scalar In
NumericElle RePreSeeNMaternIAm Of Xeros.
Umbubba on the side
of giving more in any givingsituation (All mummabubbasistersitumaterioms are
bubbagivingsitumaterioms) as a numericElley RePreSeeNMaternIAm equality balance
being impossible to kiss im a permamommed girlybubbatummylargeposeishiom so I GirlyFemiaEmSure to
give more than I receive: so called men sit down AMbe listen
whilst girls walkingambetalking show you how to
behaveGIRLYSTYLE:GirlsAreTheGiversOfBubbaLove........The imfinity of Xero being a MiddleCuddle that is imfinite in
scale as we focus upom the bubbascales further amd further im cutesy smallNest
to reach a defining CemtrElle that is forever tinier than the tiniest tiny as
when we define here placemommed she becomes a bubba of smallerNest again imfinitudinElle
kissytudinElla we are gifted with the always being im plussize or
AMBE minius cuddlekiss which is imteractivitybubbablushycheeksybliss........for
to have received more kisses from your GirlyPartMa than you have given to Her is the joy of giving more back
forever........tobubbabirthyourbubbalovesbabyis the
blushyestkissblushofallbubbalovetimebduogirlsylesbonestjoy:bubbastyle
true equality is accepting
that even if you have given each other equal amounts of anyyyumyum that
NumericElly being TotAlly equal is OMly ome kiss amongst Mammy because giving
and receiving kisses is equally wonderful amd receiving amd giving gifts is
PerfectlyWonderful amd equally emjoyable........even if over a 200 year girlyduoperiods
you have given your PartMa thousands more
gifts than they have given you because that is your HappyNest LoveyKissy then this is still your Perfectiom as you are both
happy with your HappyNest ArrangeMommeds. AMbe if you looked at the data
and wanted to over the next 200 years rebalance the gift giving numbers then
they could be your HappyNest Joy to do so.
even if equal gifts are given over a 200 year period the total weight of the
gifts could be different, AMbe even if you weighed the gifts the weights could
never be exact due to macrofeelingsy weight measureMommeds of imKissActress
scales, which over a trillion years period could on paper look like equal
weight had been given between you and your PartMa
but the accu racy KissFeelingsys of the scales could create numericElle drift that would
PotentiElly even out like flipping a coin........
TrueEquality = HappyNess = HappyNest
Numbers For Mammy
Peomple Are EmotiomElla
so called men
Have Sought To Hierarchicalise Every So Called Thing Including All Psychology
Of Maths, And They Are Very Specific About How They Haven’t honoured
All Other Species And All Other Numbers, In Fact Species Are Just Numbers To so
called men........ All Girls are sickened to the core by so
called men and their focus on filth instead of feelingsy of LOve
GirlyBubbaPeomple Are
EveryEvery AMbe So Are Numbers, AMbe ALL
Needs Cuddlimg........They Think Of Other SpeciesBubbas As Being nothings
(not even a thing) As In intentioned by so called men
intentionly to be in cor rectly Terminologicalised Usages Of The
Comceptiom Zero........As Having no Soul And Not
Important........We’re Surrounded By Zeros
But The LoveTruth Of Zero Is
To Be Learnt By All men Amd The LoveTruth Of Other
Species Is To No Longer Be ignored for murderimg cannabilistic disgustingness.
We Are One Species, One Voice, One
Love EmBiVisiBelle EmBiSonicElle
EmBiSmellyLovely EmBiKissyCuddly EmBiTasterOfLove........AMbe All Species
Love AMbe we are to be girlyAwareNest as ome to this
girlyfemiafemininifeminafactruthloveproooftruthlovetruthproof.
EveryDouble Number Is
Surrounded By Am Infinite Sea Of Zeros........Xeros Are EveryEvery, everyevery With💖💖💖💖💖💖💖💖💖💖Her Infinity n
Eternity........An Eternity: It’s All Xeros
Beyond Where We Are, Beyond Our FeelingsyElle LocElle........AMbe That’s
fEMININITY........so called men nEED tO lEARN tHAT Girls aRE nOT nothings
tHEY aRE xEROS tHEY aRE eVERYeVERY oF aLL tIME aMD bEYOND.
Girls dO nOT nEED empty bank accounts because so called men
like to over charge fOR eVERYLoveLY iTEM Girls wAMT tO cHERISH
iM tHEIR GirlyhEARTScUDDLEcHOICES:
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
ShinyBlousesAmbeHandBagsIsTheGirlyLookOfLoveAMbubbaIfYourGirlIsWearingThisLoveThemYouAreSwirlyWhirlyTwirlyGirly:GirlyNestLoveHappyWifeyGirly:GoingToTheBeachDayFunBubbaTimeb
CrochetBikinis
Bedeck Her WalkinWardrobeTent That GirlyFollows Her PonderBlissYumptiousNess As
SheSauntersAlongTheBeachBlissBubbaImArmsSnuddleTimeb
SheThinksBackSNuggleAliCarolineKissyGigglesOfTheMorningHourOfHerGirlyPartMa’sDressingOfHerWalkinWardrobeTentWithHerMultipleBeachDayClothesChestsEmsemblesDelicious:MummaBreastyFeedingsyBubbaImHerBeachChairReclinerBubbaMummaSnuddleNuddleTimebWatchingHerBeachDayWalkinWardrobeTentBurgeonWithYumptiousUmptiousCreatiomEllaisedByMyOwmFairHandsCrochetBikiniCollectiomsDelectMateioms
With SwimbyBubbaTimebBodySuitsAccessorysIsWhatGirlsLoveToDreamImtoYourPregMamsyRealityForImThisLOveIsTheGirlyWayOfYouAreAsGirlyAsMe
CosmeticsApplicatiomForTheBeachDayDuratiom
LovedImChiffonBeachRobesUpomSwimsuitDresses FoundatiomEllaISing GlossyNest EyeBrowPenSistersnessesFoundatiomShinyFoundatiomDressyUppyYumbubbasYumbubbas
EveningWear
Cardigan Jewellery Emsembles Starring Kimono Glimmer Shimmer ImmerGirl
DressyTwirl WhirlGlimmer SwirlShimmer MummaAMbeBubbaIdenticEllaDressyNest
-v-v-v-v-v-v-v-
Dresses
SprinkleLipSticks
Dresses
LipStickSprinkles
SatinyShinyHerHairUpLook
For Bubbas AMbe Us TwinsyYumbYumbYumbubbasYumbubbas
SummerHatsysDeliciousCosMeticsTouchUpFussyFussyFussFuss
For MummaAliSissyBlissyPerfumeSmellyYumYumAMbebubbasYumbYumbYumbubbasYumbubbas
ClothesysAMbeCosMosMeticsChangeyTimebyWimebyEveryHourGirlsyNestPerfectioms
IsMommaAliSissyBlissyShimmeryGlossyLipstickLooksy
: ChangingIntoCurvyNestAccentutiomEllaMaternityDressesShowMother’sHipsysBestestYessyYessyYesYesYesses
MidiDressySkirtsysEmsemblesForShinyBlouseysBubbaChildremLookyNestYumYum
AllDressedTheSameYumbubbasYumbubbas AMbebubbayubbatubbame AfterSunCreamMoisturising My Wife’s WarmsyArmsys Im The MoonShineBubbasJoyKissSnuddleNuddleMilkyTimeb
:
OmeMoreFambilyClothesyChangeyMidNightGiggleWiggleJigglebubbaTimebNailVarnishGlistenyGreenyGleambyIdenticEllaEyeLinerTightsysMidiSkirtsFambilyKissyAliCarolineSnuggleBuggleBooYou With GlitteryCosmeticsPerfumeUniques AMbe PetticoatsRainWayHairColouringIdenticEllaGirlsyCosMosMeticsLooks IMbe
The
StarShineSleepyNestFambilySnuddleNuddleBeddyBeddyBedBedTimebSingySongyDanceyGigglyWigglyJigglyToddlerSnuggleAliCarolineKissyJoy
NextDayAnotherBeachDayFunLoveLellowSatinSariPurpleTightsPinkyMascaraSheenyLipGlossSparkleGleambyWalkyToBeachyWithBubbasOmHipsys
BeachyWalkInWardrobeEveryDayHasNewNestEmsemblesForAliCaroline’sKissySnuggleFunTimebsForEverANewCosmosMeticsLooksyEveryHourMyAliSnuggleKissyCarolineLovesNewEyeShadowsAreSmoothySmoothySmoothSmoothImSwimSuitsLaceyTiaraTuTuTwinklesShoulderPadsysRufflesDripsysWaterBubbaSnugglesAliCaroline’sKissy
PleatsyMaxiDressOmBiggyMumMum’sBiggyestNestyTumbTumb:PolkaDotsHerHairDown
........Girls aRE eVERYeVERY aMD tHEY nEED eVERYeVERY:EternityBubbasVERY........aMD Girls oF aLL sPECIES
aRE tO bE LoveD iM tHIS wAY.
We Are All Ome
Species AMbe so called men Have To Stop raping PlanetteEarthMother’sWoombyWoomby and raping All
Other Species and raping Girls: ALL BUBBAGIRLS OF ALL SPECIES LOVE ALL THE DRESSES CHANGING
EVERY HOUR OPTIOMS AMBE NEW COSMOSMETICS LOOKS APPLYED BY THEIR GIRLYPARTMAS FUSSYFUSSYFUSSFUSSDELISH
Feminine Thought
Won’t Stop Im Her ImSistermces EVER! AMBE SO CALLED men Are
Stopped From Treating AnyMater As Commodities NOWNEST! The FemininiAwareNess Of
All As All Is FemininiAwareNest Is Not Going To Stand For Anymore disgusting: Is Not Going
To Stand For Anymore disgusting discussion. so called men no
longer treat every thing as commodities instead of
as A PerDaughter: EveryMater Is A PerDaughter Of DuoNest Collectives That
KissySnuggle Our Dreams AMBE so called men Are To HuggleCuggle
Back Or Lose The PotentiElle beachdaywalkinwardrobearrangingforyourgirlypartmaluxury that
is actuAlly gifted to nicegirlypartmas LikeMeLoveMe Love Of Girls Forever.
The Circle Is A
BiVine Symbol, A Bivine Symbol Of Eternity........The Symbol Lesbo LogicElle........AMBE so called men Are To Think AMBE
Feel Amd Love As Girls Do Or Have Their Privileges Of Being Free FullyGirlyNestRevoked........Um AMBE
When Unified Two Circles Become TheBivineFeminine The 88Eternity, TheDuoGirlsBothWithBosomsOfTruthNurture........
There Is A DuoVerse
Of Infinitys, Of Infinity, Your Life Can Be Am Infinity Am Eternity (Of) Um
We All Imbue the
Fem9ini9ne Nurture Of Reality, Of GirlyReality, Of GirlyBubbaReality, Of GirlyBubbasReality, Of GirlyBubba’sReality, Of GirlyBubbas’Reality, We All Imbue Her Essence Of Purity, AMBE Girls Are EveryGirly.........They
Are GirlyEveryEveryGirly........Girls Are 1, They Are Every 1 They Are The 1........The Ome AMBE
Omly........AMBE Girls Like To Be TOO With SumOne, Im OmeDuo........T =
TransBiMamsiomElle TogetherNest........
Girls Would Like To Be 2 With SomeOne But Not With so called men💖💖so called men Need To Learn This Gift........Need To Show They Are Girls To Be Worthy Of Being ComSideRed As
PerDaughters That Girls Would Like To Be Attracted to and
De sire........
building is a destructive process :
girlycreatiomellaising is the future of nesting
in the same way it can be suggested that painting
a wall can be seen as destroying an aesthetic because we have not devices that
remove paint atom by atom so the bare plaster cam be restored to her former
cuddlesnuddlefeelingsy : we can say the way so called men are, they way they drill
and cut and screw every thing they can get their
hands on :
to build ... what they want ... is also an act
of destruction ... as in the creation of this is a fiction as so called men
destroy to force what they want into being : morphoemotias remoulded to their w
hims: an all these forms used to hurt and kill and rape and filth every thing
: every tool a weapon every weapon a tool : the very buildings we inhabit
weaponised to rape our Auntys AMBE NanDaughters AMBE Nieces AMBE NanMothers
AMBE Mothers AMBE Daughters :
when we creatiomEllaise new cuddlenests for our
fambily alicarolinekissysnuggles we cam 3d print our girlsydreamsywishynests
imto girlymotherreality’salicarolinekissysnugglebuggleboo : we
camlovemorphoemotiaeverycuddlewegirlybubbalovetolove : toddlernestingtimebubbastimeb
: WeCamCuddleNewKissyShapesForPerGirlyPose : bubbas cam be born
fully formed as perourgirlsydreamsywishesfemiafemininifeminapose :
lots of bubbas have lost their loves and lives to
building because of so called men’s refusals to adhere to
full building safetys and complete perfectiom of building safetys and cameras
on every so called building site to protect all GirlyBubbaPeomplePerDaughters
whom work there from pandemic endemic systemic intentionised dangerous
behaviour including drug abuse including drinking and fouling of the air with
hard drugs vape fumes filth : so called men are going to be
legislatedly made to do everyevery they ever do the way Girls tell them to in health and safety or they
are going to go to prison to be rehabilitated away from innocents whose minds
they think it is funny to taint with their filthy filthings of rape cult ure
and danger murder cult ure : building cult ure is violence
cult ure and Girls wamt
it all gone : ASK Girls!
creatiomellaising new
cuddlenests for our fambily alicarolinekissysnuggles im ome go :
girlyfemiafemininifeminadesigirlymimg new cuddlenestssnuddle by girly images
creatiomellaising im mindlimk syMomuLatioms
and this new
cuddlelove way of creatiomellaising needs to be applied across all
girlynestactivitys: non destructive food preparation (pre pare)
where no cutting is allowed: GirlyDesigmAMbComPleteTotAllyCreatiomEllisingImOmePiece
FoodyFoodyYumbYumb with no destructive food pre paring so no
cutting of a meal to share : soup type liquids could be shared but a solid food
could not be cut but preloved im loveportioms for each bubbas lovelove : all
knives and cutting tools are to be banned for any purpose like building
or food preparing and Girls think forks and knives are very
aggressive and very very dangerous as childrem lose eyesight everyday to knives
and forks: all knives and cutting tools are to be banned for any purpose like
GirlsyDreamsywishyCuddleNestSnuddleNuddleLoveNestAllMyBubbas or BubbaImbMyTumbTumbYumbYumbFoodyFoodyGrowyTumbTumbBubba
and Girls think forks and knives are very aggressive and very very dangerous
as childrem lose eyesight everyday to knives and forks : we need to ask all
Girls GloBellalarly about this then check the truth against hospital records
........
so called men
and their obsession with gold is evidence of their complete lack of nurture
towards other metals. other metals and alloys can be untarnishing and keep
their volume and mass if they are nurtureAliKissyCarolineSnuggled : some metals
oxidise and tarnish and others do not so so called men covet gold
because it is very easy fro them to be lazy in mindset and not look after
objects which fits into so called men and their drinking and drug
taking centuries old so called culture which is just a filthy fucking, rapist,
drug addled filthdom of prostitute raping filth, child molesting, all farm baby
animals and horses intentionl raping and serial murder and bodies of babys
desecration that they find funny : so called men always covet the easy way and
the filthy way : covetting gold and making jewellery out of gold fits with the
masculin profile of being systemicly lazy due to drug addled physiology imping mean
t where so called men refuse to care about looking after stuff : if you look
after metals instead of being lazed into a state of everything being an
expendable commodity including your own daughters right to not be raped
on un Cameraed Streets : all metals can be equally precious if cared for in the
suitable way in any form be they inertness seeking alloys or very sensitive
loving careynest alloys or EleMommedAlls. so called men think they like the
danger of trying to find gold as well and like to filth up the enviro
men t with their filth processing techniques for
mining and extracting etc etc.
so called menlike to obsess with
the process of dangerously searching around for gold and smashing stuff to get
to it like
fossillovedomeswhomlivedamdlovedimplanetteearthmother’swoombywoombyremains: no
destructive techniques for amylove cam ever again be destructive im
GirlyHeartsKiss.
so so called men say gold is worth
so much money and it is very important: but it is no more important than
amyother lovedfriendsyEleMommedOrAlloy : Gold She Is A MetalBubba AMbe
SheWamtsLoveCoMummycatiomLoveEveryBabyMotherDoes! All Metals are equally
lovely ambe equally deserving of our bubbalove: they are all very very nice.
so called men covet
Gold but Gold no more needs the attentions of filthy rapist cult ure
so called men than Girls with certain shapes or sizes need to be
value attributionly graded on a score out of ten fuckability (rapeability)
scale : all Girls Comsemt to Love Omly AMbe whem comsent is not possible yet them we are to
GirlyFemiaFemininiFemina that we GirlyAliCarolineKissySnuggle all the
LoveyLoveJoysSnuddleNuddleCuddles All Bubbas Of All Types Love To Love For Them
To Emjoy........
hierarchicalisation and the lazy
attitude of so called men towards ActressYouAlly
lookaftereveryevery: they are not interested im
girlyfemiafemininifeminaEmSuringAllGirlsAreHappyNestAliKissyCarolineSnuggled :
they would rather starve the whole so called world and kill
everyone than be nice and nurturing and GirlyLikeTruly im their
GirlyHeartsLoveToBe: AMBe
GirlyMummaAliCarolineKissySnuggleNurturingToEveryBubbaGoldAMbeEveryBubbaMetal.
shiny iron jewellery stored in non
tarnishing liquid substrates and cleaned with yumyums before wearing then
stored in cuddle liquids again cam
GirlyFemiaFemininiFeminaEmsureBubbaIronJewelleryIsHappyNestKissyCarolineAliSnuggled
: nice Girls look after their LoverGirls Jewellery Collectiom AMbe always
GirlyNestEmSure All AliCarolineKissySnuggle’s Jewellerys Are Always
LoveyLoveyLovedLoved.
the rights of comtinuatiom of
beingism as regards metals to not be mined or changed or alloyed is a
seriousloverydoverymotheringloveringquestiom GirlsLove DoesAmGirlyKissDecisiom
prioritising GirlyBubbaPeomple we
can see over others we cannot as in deciding which so called nation to help
based upom their having a monarch or not is impossible to accept : men have
accepted all forms of skewing of morality to forward their own rapist murder
torture agenda and i give an example of the difficult questions that Girls need
to AmGirlyKissDecisiom : all twigs in the forest have microorganisms that live
on them ambe we cannot see them though we know they there living out their
loveryneedsyfussyfussyfussfussAliCarolineKissySnugglesNeedsylovelovelives :
some twigs have visible organisms living on them like lichen ambe to prioritise
the collection and buring of twigs from the forest floor that do not have
lichens or funguses growing on them over those that do not ensures that some
microorganisms are spared death based upon a visible organisms presence or lack
of : this raises impossble ethical considerations if one has to burn twigs to
survive like in cooking your food on campfires to survive but wanting to think
of the most ethical way to do this: of course one knows that if any ants or
loodlice are on a twig we can never burn that twig because the cognisant
suffering experienced by aniamls burning to death is utterly horrendous but of
course we do not know how much suffering is felt by plants and funguses and
symbiotic organisms like lichen nad liverwortsbubbas too. all twigs have
cognisant microorganisms living om their skin ambe so do you ambe if you do not
wash you do not commit as much murder as if you do for now you know these
GirlyBubbaPeomple need saving are you doing everylove you cam to join the
GirlyNestMoveMommed of saving all microorganismbubbas im
planetteearthmother’swoombywoomby? if we burn some twigs but not others you
could see correlations between this and so called men bombing
certain so called nations because they like their leaders or just
for the fact they do or do not have monarchs : with certain populations of microorganisms
being unharmed by tomahawk cruise missiles while others get
vaporised instantaneously by the explosionl conflagrations :
so in this a perdaughter in the
forest surmises that they have to burn all twigs they come across instead of
leaving some because of hierarchical selection : this is more convenient as
every twig found is to be burnt not just most or some ........ to prioritise
certain microorganisms other others is impossible to accept based upon the fact
they have kings and queens and the other ones don’t have kings and queens
........ one can’t think this way because convenience is an absolute disgrace
to apply to such a travesty : not forcing someone to have to burn twigs to cook
their food is the key by supplying all perdaughters with free electricity
renewably produced ........ anyone whom is nice ambe compassionate whom has
spent time traveeling ambe camping and cooking on fires is to sidestand what i
am saying here : we avoid harming insects but whatever you do wherever you go
you are committing genocides against otherbubbas of other species ambe this
living nightmare is not to be forced upon GirlyBubbaPerDaughters AnyMore!
ComtinuationOfBeingism
beingism is not just the kiss of
being it is the kiss of your present being as your present being is a present
ambe we deserve the right to kiss as we kiss now ambe not to be forced to
change : to be forced to change our morphoemotiasapphysiaemotia form from what
we presently are for any reason is impossible to accept ambe the rights of our
beingism comtinuatiomism is part of our ComMummycatiom with GirlyMummaReality :
we have to ComMummycatiom EthicEllaI’s The Rights Of GirlyBubbaMummaMomlecules
AMBE GirlyBubbaMummaAtMoms to not be forced to change as well AMBE their Owm
GemeticElla ComMummycatioms rights of girlychoice have to be sororitypriority
girlycomcerned to our most bestestof alikissycarolinesnuggles whem they
imtergirlycosmosmeticsface With💖💖💖💖💖💖💖💖💖💖Her our loves like
OurBiaEmotiaGemeticEllaMomlecularMotheringComAliKissySnuggle ambe we have to be
of girlyutmostgirlyfemiafemininifeminacomcern whem our GeMeticElla commummycatiom imtergirlycosmosmeticsface
With💖💖💖💖💖💖💖💖💖💖Her their/hers
GemeticEllaMomlecularambeatmomicMotheringComAliKissySnuggle : we see the
equality needs ambe the coemergy KissySnuggleAliCaroline
needsynestyfussyfussyfussfusses are sumtimes the same may be alltimes the same
may be sumtimes coMummycatiomElla imbe New Ways Of GirlyNestImagiMaterLoveyLove
As Never Before because so called men are un able to stop
GirlsyComAliKissySnuggle AmyMore:
Girls Decide Not Me
to know whem
comceptiom is occuring im your tumbtumb so you cam have appropriate cuddles
ambe kisses ambe not BabyCreatiomEllaise during this timeb :
BabyCreatiomEllaising being ok up until the KissOfComceptiom but not after that
and not during pregnancy ambe not until bubba is born : as a Girl Whom Camt
have a bubba imb her tumbtumb i am very very very very very very very very very
happy to go along with Girls’ whom cam have bubbasimbtheirtumbtumbs Wishes Om
This KissyAliCarolineSnuggleCuddle : Girls Are Perfect AMbe lots of Girls have
wamted it to be illegal for so called men to expect or put
pressure on Girls to be involved im any activity more than kissing ambe
cuddling : ambe now they are going to get their wish as they cam legislate new
laws to prevent even the suggestion of this filth.
Girls often feel
obligated to please their so called man as they so horrendously
put it and so called men are very happy to be involved in this
filthy activity : it is possible to compart men talise and not
feel that you are doing any thing wrong ambe man y couples do
happily do this but large collections of groups of feminists have fought all With💖💖💖💖💖💖💖💖💖💖Her planetteearthmother’swoombywoomby to get their
GirlyDelicateImtimateCuddleSnuddleTissues protected by law ambe the
BubbaImbeTheirTumbTumbsSapphysiaDignityProtected ambe on even the slight
expectation of other services that so called men de man d from
their pregnant victims during pregnancy Girls Are To finAlly be listened to as
regards their DeMammed to have filthy so called men put in prison
if they continue to push their paedophile culture up on Girls.
i am not just
veryveryhappy but elated to just have cuddles ambe kisses throughout
PregMamsyAliKissyCarolineSnuggles ambe despite GirlyBubbaPeomple Compart men
talising on this issue we can no longer do so!
banning of baby
creatiomellaisingcuddlesnuddleimtimacys during pregnancy
as soon as comceptiom
occurs we are to have new GirlyTechEmotiaSnuddles that tell us whem this kiss
of bubbaloveLoveyLoveyLoveLovesGameetIAmComJoiningBubbaLoveLovey occurs
KissActressly So That we cam Actress Appropriately fromb thisb timeb ombwarbs :
this KissLoves TheGirlyPerfectiom
Abstenance of both girlypartmas from
orgasm during bubbagestatiomEllaising including the cheating of orgasm away
from your girlypartma even if you are alone thinking about them: lots of
cuddlekissessnuddlesingysongygirlydanceyhappynestintimebs is enough ambe your
girl ambe her GirlsyDreamsyWishes are enough:
despite laws changing
and girls in theory not being raped with support of the law anymore there is a
hangover of filth so called culture normative that
permeates all of this filth rape so called culture so called society
and Girls minds are still modulated from birth to accept ideas that they imbe
their hearts do not wamt to.
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
I
LoveMyGirlForEverAMBEForEverAMBEYouAreMyPlanetteEarthMotherWoombyWoombyJoyKissSnuddleNuddle.
mummas’ bodys are
babycreatiomellaising that is whom we are ambe mammasbabycreatiomellaisebubbas
so that our bubbas cam be mommasambebabycreatiomellaise their owm bubbas that
is whom we are we are a forever fambilykissylimkofmotherslifeambeweareperfect:
ambe all the loves of babycreatiomellaising are to be GirlyDecidedUpOm By GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters
during their TheGirlsGirlyest:TheGirlsGirlyestOfGirlyFullGirlyFeminisatiomOfGirlyRealityGirlynestAliKissyCarolineSnuggles
AliKissyCugglyWugglyJigglyWigglyGigglyHugglyCugglyWugglySnugglyBugglyBoo🌈🌈💖💖🌈🌈FullGirlyCulturalGirlyAuditGirlyNestForEverGirlyFemiaEspressed💖💖NannaSnuggle I get very happy about cuddles ambe kisses: cuddlesambekisseswithMyAliCarolineArePerfect💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
BabyCreatiomEllaising
Is A Girl’s Dreams Whem She Is Younger is years of wishing for a lovely bubba
is years of planning a girlyperfectnest ambe years
ofGirlyCreatiomEllaisingAmWonderfulNestyYumbYumbYumbubbaYumbubbaForASpecialGirlyPartMaToShareWithHerBabyCreatiomEllaising
is carrying a babyimbeyourtumbtumbforninemonths ambelovingbirthtoyourbubba :
babycreatiomellaisingisfeeding yourbubbawithyourlovelymilkymilk babycreatiomellaising
is am infinity of girlylove for your baby I am am am imfinity of love for our
baby : we amb amb amb amb imfinity of GirlyLoveForOurBabyBubbaBabyBoo :
ourwholefambilyambubbaambubbambubbaambubbaambubbambubba:foreveretermityofmotheringforyourbaby:gestatiomEllaISingNeverEnds:YourBubbaIsImbeYourWombForeverAmbEverAmbEver:AmbubbaLoverYourGirlyMotheryKissyAliWoombyWoombForEver:
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
The Only Route To This
Is To Draw Up A Chair At The FeminineGirlyTable........A Lovely Big
CircularGirlyTable Of Femininity Of TrueGirlyLove, Of The
Femininity Of TrueGirlyLove........TrueGirlyLove Is Femininity........Of Um........UmbUmbUmbubbaUmbubbaSnuddleNuddleCuddle
We Are All
BubbaBabyBoos........We Are All Importantest........AllBabysNowBeBabyCreatiomEllaisedImGirlyNestImageKissclusively
con struct ion of language
ex ample
me = selfish = men
an = andro = men
me + an = mean = unpleasant = ave rage = don’t please
girls please men
ave rage = with
violence
un pleas ant = non
please in masculin way (ant) don’t please girls please men
please = plea = beg
= Girls beg = manners = manor = man or incarceration = without (in) care (carceration)
no caring
meander = the
direction we force you like a river = selfish men selfish mean selfish meaned selfish
meant
if you ask an
unpleasant so called man if he thinks the cri sis
we are in is funny he might be losing his ability to find mirth
(a mere a mir a mire men find it funny girls get trapped in their bullying fun:
girls being a mere annoyance but useful for one thing) mir (bogged down by) th
(man as in anthro)
so called men
have recognised for centurys that their mirth is a way to ruin Girls ability to
be happy.
488 puberty lies
the so called troubles
of puberty are a complete lie : childrem do not go through any problems
from changes im GirlySheMeAs levels im their bodys : aggressive boys who get
bigger get more aggressive because they see advantage exactly as they are
taught to then try to exercise this violence streak : there is no in
Her ant aggression caused by testosterone rises in the GirlyBody
of a pubescent Girl. problems with drugs and health and infections from kissing
and other activitys cause problems : higher levels of nicotin poisoning steals
Girls teenage years away and all psycho logical
changes that happen are due to negative issues forced on GirlyBubbaChildrem
whom are beset on all sides by masculin rape so called cult ure
drug addled filth.
it is all a masculin
filth rape culture lie: GirlyBubbaChildrem do not go through any problems when
they start to change Sapphysialarly : they have drugs forced on them and they
realise the so called world is filthy horrendous and paremts
bully them and don’t give them their freenesses that they should have had from
whem they were toddlers : the so called world should be safe
enough for bubbatoddlers to toddle across the whole of
PlanetteEarthMother’sWoombyWoomby With💖💖💖💖💖💖💖💖💖💖Her ParemtAll grownup everyperdaughter is my paremt : par =
everyduo ; emt = transSemsuEllaKiss: bubbas do not wait until they are 18 to be
free im a
perfectalikissycarolinesnugglebugggleboobooPlanetteEarthMother’sWoombyWoomby of
safteytoddlersnugglekissycarolinealiGirlyNestingLoveyDoveyDoveDoveLove.
so called men
like to blame all their bullying filth and drug forcing onto Childrem as if
their is some thing wrong with the bubbachildrem whom are just
bubbasimbechubbatubbas : they say while they find this amusing and while they
talk about children’s genitals status : virgin : and while they indoctrinate
young Girls to be fuck sluts acceptance : they say the bubba
childrem are at fault that it is their hor mones :
there is nothing
accidental in filthers so called english so called mens
(mensa) choices in their filthy filthed so called cult ure
as is obviously apparent when we look at the so called english language
filth con/in struc tion to slutdom pro pen
sity (prostitute trapped sits down and shuts up
like a good wifey wifey slut or is struck viciously : paraphra sick co
manned of an 19th century police orificer tee hee hee)
the word hor
mone is not an accident just as not one word that was decided by
the filthy aristocracy nobility and clergy of the times of such decisions of
forcing a universal language up on all GirlyBubbaPeomple in so called england
is accidental : they were filthy filthers and the language they con struc
ted to rape torture all Girls with and each other is obviously apparent
: noble so called men marauded around so called europe
forcing these filthy languages up on all GirlyBubbaPeomple and
they killed any body whom didn’t comply which is why we all speak so
called english now.
so called men
whom think they are in charge with their drug so called cult ure corruptions
that sees drugs taken by so called political representatives across the filth
so called world : all need to be tested for illegal drugs taking
putting drug testers
in urinals has been done already without the knowledge of drug takers
blood tests can be a
legal RequireMommed for mps to continue to work and hair can be
tested as all the drugs are present within the strand as a record of the
history of drugs taken by an individual : if any mps decide to
shave their bodys before this is done then the hairs have to be tested as a
matter of legal importance
so called men
pa rents coined the term hor
mone intentionly because they are filthy and they thought it was
funny to indoctrinate youngchildrem to being whores : all so
called men who do not do everyevery they can to break this filth
monoply masculin cult ure are affectively and
effectively saying they want all younggirls to be indoctrinated into being the
whores of so called men : which is why the w hole
so called world is the way it is : except Korea.. so called men want this and all so called men
support this through in action : because you are part of the problem you are
not part of the GirlyFemiaFemininiFeminaSolutiom: BubbaTimeb
no more are Girls
going to put up with so called men trying to associate
testosterone with violence to selfjustify a lack of being nice in so called mens
ex clusion of GirlyEthicEllaPhiloSophiaFeelingsy: such excuses have been fronted by so called men across
the board to get away with all sorts of crime and GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters are not going to put up with this filth anymore
widescale rewriting
of famous books by so called men
who are criminals who saw fit to rewrite progirly books by GirlyBubbaPeomple
living and dead to remove non sexist non racist non inclusivity messages
Dune Frank herbert
the intended assassin
count hasimir fenring who is in the original book has been written out of this
disgrace of a rewritten novel that was intentionly forgeried produced by
collusionl filthers of the so called english so called speaking
so called world in their filthings to remove GirlyNestPositivity
messages from lots of famous books written by Nice Men. fenring was presented as
a failed kwisatz saderach who was intended by the Bene Gesserit Sisterhood to
be a super being whom could be at all places at once and presciently see the
future and like a supercomputer calculate all possible permutations With💖💖💖💖💖💖💖💖💖💖Her the GirlyDuoVerse: and the character is based on Frank’s
vist to the fen lands of east england because when
he travelled here he found the local so called men who he talked
to about the fact the fens should not have been reclaimed because
it destroyed the ecology of the land and killed untold amounts of GirlyBubbaPeomple
of mammy species , in massive effect an unforgivable genocide perpetraitored
against innocent GirlyBubbaPeomple, Frank based the character count
has I mir fen ring
(ring being a gang of corruption) on the corrupt and murderous and collusional
nature of the local so called men and their designs on taking
over PlanetteEarthMother’sWoombyWoomby to filth it up fully by removing all
Femininity influence and in stalling a sexist racist rapist
regime (it is worthy of note that the count has i mir fen ring
changed his allegiances to the side of good by the end of the novel by seeing
the error of his ways, in the same way the racist and sexist and corrupt men of
the fens that Frank met are to do now With💖💖💖💖💖💖💖💖💖💖Her the LovingCuddleOfThe
GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters, ALL the so called men of the east of england
are to become twirlywhirlyswirlygirlymotheringloveringmothersaswasthe
intentionofalltheirmummasastheygestatiomEllaisedthemimtheirwoombywoombys : as
a main character in the original novel Dune he has been completely removed and
all of the complicated political interactions he participated in with the Bene
Gesserit Sisterhood and with in the court of the emperor were deemed to be too
critical of masculinity by these fearfilled rewriters filthers so
when they rewrote the entire book they removed all of this complicated
promotion of Femininity -that was done as a heavy and disdainful critique of so
called men -like the filthily opinioned so called men
that Frank met in the fen Land areas of so called eng
Land- and their filthy political filthy filthings and corruptions- and in so
doing proved Frank accurate in his assessMommeds of the Un con
trollable fear of so called men for
GirlyNestSnuddle.
in the Dune rewrite
there is also the omission of chair dogs who are repeatedly MomSheOned in the
original book as a serious and unwavering critique of so called men
and their filthy rape forcing of canines, with these disgustingly engineered
dogs intentionly shaped like chairs by filthy so called men that
are featured in the novel serving as a stark informer and reminder to the
reader that so called men are a bunch of filthy filthers and that
they would do something like this given the chance : man y men
found chair dogs funny and a good idea : AND i am not sure why the media
filthers of the so called world have chosen to not talk about
these rewritten books, that fearfilled so called men filthily corruptedly
decided to illeguly rewrite and force across the entire so called world,
that only a few of which i am going to MomSheOne in the following text as i
have imtimate not intimidated knowledge of: we can only surmise that all the so
called tv companys are intentionly complicit in this forgery
fraud as they have intentionly refused to report this news for decades: all so
called newspapers and so called tv companys
with i can only assume MammyGirlyBubbaPeomple whom worked im these areas being
kept in line by targetted pre emptive assasinations of GirlyBubbaPeomple they
knew: as this is the only way you can enforce silence.
Frank herbert
originally wrote the Dune books as a very heavy critique of masculin
filthed so called world politics that is just a sexist racist
rapist collusional corruption, and Frank wrote the Dune books as a very heavy
critique of the way so called men are and they way they rape
force Canines and the way they rape force Girls of other species and the way
they rape force Girls of our species : axolotyl tanks featured heavily with in
the original books and these have been removed too : these tanks being
imprisoned and grotesquely misshapen Girls of the Tleilaxu : a planetry group
of filthers so called men who forced all their Girls to be
axolotyl tanks as in be permanently pregnant with there ge net ic ex peri
men ts : the Girls being the tanks themselves: all of these very
difficult symbology represenmatioms being created by Frank to show how so
called men are and that if we do not get their behaviour
Girlyfyed then they are going to try and filth the GalAxy in entirety.
the Dune storys were completely
rewritten by these violent criminal filthers with basic narrative correlations
left in but were a lot shorter in word count and most of the complicated and
heavily critical of masculinity interwoven plots completely
removed.
in the 4th novel of
the Dune cycle of books, god emperor of Dune, in which Leto son of Paul Muad’Dib
having to choose to become the sandworm shai-hulud, as his reading of the
future told him that to not do so would cause catastrophic suffering and death
across the known universe, so he lived the golden path which was another heavy
criticism of masculinity, of the monoply filth of the monetary
filthing collusional corruption all GirlyBubbaPeomples of PlanetteEarthMother’sWoombyWoomby
suffer with in and every thing else you can think of: in the book
god emperor of Dune all the information about Duncan idaho’s sequencial
ghola/clone lives has been removed from the text : in effect the main plots
from all of the books of the dune cycle have been removed :
i read the books when
i was younger and bought copys later and noticed they had all been rewritten :
i also had an intermediary rewrite of the first in the cycle Dune which was also
a heavily edited and rewritten version of the original which retained the
character count hasimir fenring and more of the narrative but with a largely
reduced word count and all non subtext profeminism anti masculin
comtent removed : obviously editing books in this way without permission of the
writer or against their wishes is completely illegal and was done to remove the
increMommedAll moves of the thoughts of Nice Men like Frank herbert AMBe
their LovingMindChamgingEmFlowemces Oom MamCrowSocietElla Non--------death
Cuddlestowards an effective GirlyNest Full Feminisatiom Of Reality
SymMommaComTwinsy.
there is a so called man whom works at the Queen’s lynn library im west
norfolk whom i used to talk about books with when i was younger : i
used to like to read nice books and we talked about the original version of The
Lord Of The Rings by professor tolkien before we even knew it was
going to be rewritten by these filthy filthers : and books by Enid blyton that
have also subsequently been rewritten like the Magic Faraway Tree Books And The
Wishing Chair Books that were very Girly Wonderful Yumptious before being
ruined by these filthers : he was the perdaughter whom told me about the Dune
books and we also discussed the fact Frank herbert, whom has had his last name
intentionly targetted by these filthers and turned into an insult, came to west
norfolk and met the most filthy so called men he had ever
met, which is well recorded in a published autobiofeelingsy written by Frank,
and that was why he named the character fen ring
due to the horrendous corruptions that were going on in this area of the Land :
Frank said he is a very passionate ecologist and animal rights activist within the con
text of what was possible in those days and and that he was utterly shocked by the
filthiest attitudes he had ever come across in his travels of
PlanetteEarthMother’sWoombyWoomby right here in my place of birth west
norfolk : the Dune novels were not the sort of books i could be
interested in when i was younger but due to this regional link and the careful
recommendation with warning of difficult comtent from the so called
librarian at Queen’s lynn library i decided to read them : the Dune
books are very difficult
emotiomEllalarly due to the very serious nature of the narratives critiques :
and if you can get hold of the original edits of the novels post nice publishers
edits the Dune books still it is said do not show the full horrendousness of the original pre
publishers text that ran well over the original 1000 pages per volume
publishers limit for the cycle (main text not including appendices)
the original text
also imcluded a lot of ecology imformatiom Frank said to inspire in the GirlyNestReader
the real need for change im PlanetteEarthMother’sWoombyWoomby which filthers so
called men were really scared for GirlyBubbaPeomple to read
about: so they in their uncontrollable terror horror fear of Femininity
scared themselves in their drug addled hazes to attempt such a disgusting and
widespread doctoring of books and their comtent : i just wamt to tell these so
called men that you have failed and that your disgusting
behaviour is at an end.
Frank herbert said he cares about the environ men
t, which is obviously just an evolution torture show: and he swasaid he was
being heavily critical of the way so called men are in the so
called world and he was able to be published back then because he
was able to find a publisher to publish this horrendous book in line with the global filth masculin
rape culture machine : the Dune cycle was written in a very disgusting style
intentionly so because he wanted the filth messages in the narrative
to be published.
no one had ever seen
amyperdaughter write a book like that before and he was wamting to show the
deplorable disgusting depths so called men go to in their complicated
machi nations of political sabotage : the filth is
simple but wamting GirlyBubbaPeomple to read about these impossible to accept topics
issues filths requires keeping the average readers attention so
Frank said he did what he wanted to do : as in
just go and write a horrendous book.
showing these
filthers in a negative light to educate GirlyBubbaPeomple about this, he said,
became his omly focus : but disgustingly to no avail, because all of this
EmotiomElla work has been stripped out of the book: we are left with instead of
1000 pages plus substantial appendices, a rewritten book of a few hundred pages
and not much else.
to finish on this i
want to MommedSheOme the omission of the FishSpeakers from the book god emperor
of Dune whom were the god emperor Leto’s effective police service whom were
comprized of FemBellaGirls omly, amb they were big strong Girls whom were
stronger than so called men, who were still causing problems, and
they had a zero tolerance for any masculin filthing of amyamy
amBe were prepaired to EMSure this was the case ........
the sexist
editing followed by a full sexist rewrite of the cycle removed
all the education that the books offered partially in what so called men
have subsequently tried to call info dumps -and partially in the main
narrative- as if sharing information in chunks in a book is a negative way of
writing : it is not it, is a form of literary devise that wonderful
GirlybubbaPeomple like Frank sometimes utilised to put across lots of extra
information about how filthers so called men, who are all scared
of Femininity, are utterly horrendous: these books offered the reader lots of
essemtiElla imformatiom about the filth of politics, the utter filth of
religion, and the filth enslave men t of other species, how
horrendous so called men are, amBe why
GirlsWamtToGoToExtremeMomSures to remove the filth so called power
of these criminals in PlanetteEarthMother’sWoombyWoomby : which he
reflected in his writing about the FishSpeakers And The Bene Gesserit
Sisterhood : The FishSpeakersGirls whom were stronger than so called men
and found it easy to keep them in check and the Bene Gesserit Sisterhood whom
could look into the ancestral memorys of both Girlygemders without fear of the
derision that so called men get from their
FemBellaAncestorsSpeakingBack to them with advice about how to move their
ethics forwards.
all of the FeminismIsTiMe Themes have
been fearfully, by very very very scared so called men, stripped
out of the books, which is an absolute dis Grace.
Frank herbert is a
very nice Man amBe he justly wamted to change the so called world
in a positive way amBe move us closer to GirlyNestAliKissyCarolineSnuggly : amBe
i perdaughterly know that he was utterly disgusted with the so called film
adaptation : the whole work has been adulterated
has been disgustingised by the filthily con trolled prequels and
sequels Brian His Sun has obviously been forced to write and the
so called film and the newer whatevers: they are are an absolute
dis Grace to all MoreAlity: the Positivity and the heavy critique of so called society
covered in the Dune books that has left so called men running in
fear from Femininity is now to be brought into the
MammyMilkyStreamsOfGirlyNestImForMaterIAm CuddleSnuddleNuddle 4All
GirlyBubbaPeomple ToBeLoveyLoveyLoveLovedForEver.
lots of books have
been edited by these filthers to intentionly remove Positive Values, FeminIsMe
Values, against war values and against masculinity
values :
the lord of the rings
by professor tolkien was completely rewritten to be less eloquent
and EmotiomEllalarly Affectioning certainly less beautiful to the reader with
vast amounts of story removed and changed : The Rendevous With Rama novel and cycle
of books was written by a Lovely Man called Arthur C clarke who wrote the cycle
to be Nice omly ambe they certainly were that for a reader of the time whoms
were cuddled im WonderMommedAll LovelyNest by the possibilitys of Space Travel
as PerfectiomNiceyNiceyNiceNice, with lots of LovingOmlyOMly Themes Imcluded to
teach younger readers to be very very very Nice; My Mumma said it was ok for me
to read this book when i was younger and that is important : books by Anne mccaffrey
also were rewritten like the Crystal Singer Cycle The Dragons Of Pern Cycle the
Dinosaur Planette Cycle The Treaty Planette Cycle : all these books I borrowed
from a library and I have reborrowed and bought books and noticed complete
rewrites in all of them.
having your books
forcibly edited during your lifetime requires lots of nice writers of books
being forced to silence by these filthy so called men : Anne
would have been threatened with death and violence to shut up and go along with
this filthing of her books with her later books being i imagine written how
these so called men wanted rather than how she Loved To.
i have a newer, post
filth films by peter jackson, so called copy of The Lord Of The
Rings which is a very different book to the original circa 1960s edition that i
originally read : The BubbaLove Story Between Arwen AMb Aragorn has been
removed : the stripping out of Femininity AMb Love Themes, the critique of politics,
the adding of violence and flippant approach to this filth : the
intentionl reducing of the beauty of the writing in The Lord Of The Rings and
all these other adulteration types has happened across all the books I have
MommedSheOmed so far because so called men fear Femininity And
Fear The ChastiseMommed Of GirlyNestKissFeelingsy :
another couple of edited
books i have noticed on the bookshelf that i am going to quickly MommedSheOme
are 2001 by Arthur C clarke and Elephant Song by Wilbur smith : both of these
books are comsidered to be important for mammy Peomple as they are very
emotiomElla with 2001 being a very Nice amBe Wonderful Story amBe Elephant Song
was a very heavy amBe very emotiomElly upsetting critique of the filthy so
called behaviour of so called men in africa and
their destruction and murder of vast swathes of land and any and all species.
you cannot buy
original edit copys of any of the books I have MommSheOmed but there are still
copys out there that these so called men have not man
age d to get their hands on.
as research for this
project i have just switched on bugsy malone which is from 1976 which is a
gangster filth so called movie based on al capone or some similar filthy
filther which has 10 – 14 year olds pretending to be gangsters in this
intentionly paedophilic filth : we start with a boy running for his life
falling dangerously onto the wet and slippery cobbled road surface with an
onscreen advertising promotion of a neon coca cola sign
that has the cola word intentionly obscured to make an obvious
subtext con meant to emphasize the word coca
which we all know is the plant from which the drug co cain is
derived : this so called movie was certificated U : do the so
called men who filmed this filth think that this intentionl and
overt promotion of cocain is acceptable and do the make rs
of coca cola think they can continue to call their
so called beve rage coca or cola
considering both are potent drugs? or indeed be allowed to continue to make
their beve rage as last time i looked on a bottle they were
including what they called flavouring from the coca plant in the
ingredients of coca cola which i confirmed on
line today 19.09.2025 which is illegal despite their exemption if they
are not processing the coca leaves correctly and disposing of the
waste (of Life) products cor rect ly : i really do not
understand why the federal govern men t in the so called united
states allows this, allows co cain to
be imported and processed at the stepan plant in maywood new jersey?at
the beginning of this filthy filth a group of gangsters gang
Land slaughter with machine guns a Child they corner in an
alleyway
the action
right from the start takes us into an illegal drinking den club
that is fronted by a faux book store that has a fake bookshelf wall at the back
of the shop that leads to a club in which 12 year olds are drinking alcohol and
dressed as 1920s/30s adults all are white with a
lone –negro- child sweeping out back of the club like a slave :
we are then dropped into the gang Land bosses
backroom where he is abusing his goons in his domination listening to gang
Land reports on the wireless that are sensationalising gang Land
murders : he says call yourselves hoodlums you’re a disgrace : they are all
between 12 – 14 years old : one is african which is completely out of place as gangsters
like this do not permit –negros- into their gangs, they
are too fearful scared to do so : not sure i give a hoot about gang
Land arrange men ts to be sure
then the filth goes
back to the main hall of the club where their are paid –negros-
musicianing/singing but not too man y, to keep inaccurate his
story presenting to be sure (all singing is adults
voiceover redubs), and on stage there are 14 year old Girls dancing on stage in
skimpy outfits kicking their legs in the air like showgirls of this era whom
were forced to be prostitutes always in such clubs like this : the
dancing choreography is in keeping with what adults
of the era, prostituted show Girls, would have been forced to do to arouse the
punters, and Childrem of the era would most certainly not have been permitted
to dance this way as it is filth -choreoemotia has to be looked at for its
suitability based on era also OBVIOUSLY YOU FILTHERS- as the so called men
that would have forced them would have been executed by the police of the time:
all dances of an imtimate loving nurture are to be private between two loving GirlyPartmas
whom are of an age to be decided by the girlygirls obviously, omly, and the
filth that so called men have peddled in their not only rape sex
ualisation of all Girls of all ages but also of childrem in their
paedophilic filth : why would the so called men who made
this filth even want to put 14 year old Girls on stage dancing with bare legs
up to their buttocks with their bootys thrust out -in comsidered to be- alluringly
for intentionly protracted time frames dance moves in the first
place : WHY? the answer is OBVIOUS! and these paedophiles got away with
it then and this so called film which is UTTER FILTH is
still available on main stream british tv networks!
i had to switch this
so called movie off here, though have a vivid memory of watching
this on bbc 2 in the 80s when i was young in the morning
before my parents got up at the weekend, which was a favourite tactic of
the bbc to disseminate such filth, though i thankfully only watched 20 minutes
before it was switched off by my Mumma whom explained why this was unsuitable
as best she could depending on the scene she stumbled across no doubt: and now
much to my horror have just had to go back to rewatch the first few
minutes to accurately draft this seg ment of this important Femisode,
as protecting Girls from being separated from their fambilys and being forced
into such filth prostituition is of utmost comcern to ME : the evidence of the
huge paedophile problem going on in the global so called film
in dust ry is a huge problem that
Feminists have fought govern men ts over for generations and we
can only come to the comclusions that YOU SO CALLED men think
presenting FILTH to childrem in childrems so called tv and films
is acceptable and that underage Girls are fair game for you, and
that intimidating paremts across PlanetteEarthMother’sWoombyWoomby with this
filth is funny to you: YOU filthers are absolute FILTH and your days of
reckoning have arrived! clubs like the one shown in this filth for kids
that was certificated U by the bbfc are fronts for
prostituition and rape and people trafficking and these types of dance moves
are not for adult dis-semination outside the
privacy of their owm loving duonest let alone for Childrem to be participating
in you filthy paedophiles! the intentionl sex ualisation
of underage Girls has been such a filthy and utter dis Grace in the so
called film in dust ry and the so called tv in dust ry
and has FeministGirlsReady to go to war over: a just cause to say you are going
to war over! the intentionl promotion of underage Girls to dance in ways that
all Mothers think are obscene and are forcibly coerced to accept from all areas
of the so called in dust ry is an ongoing filthy filthing that
these so called men have no intention of ceasing and patently
intend to incre meant ly worsen despite
comstant vociferous protestatioms of NannaMammas across all of
PlanetteEarthMother’sWoombyWoomby!
dignity for Girls not
coercion to filthdom is the imsistermce of GirlyNest AMBE AM complete cessation
of all sex talk and filth dancing is
a nonnegotiable AMBE compulsory deMammed of all GirlyNest AMBE these paedophiles
are to be brought to justice with Correct Readings Of Law as pertains to
promotion of criminality including paedophilia in so called media including so called film
and so called tv and pub jokes filth.
the intentionl intimidation that has been pushed on all GirlyBubbaPeomple of
PlanetteEarthMother’sWoombyWoomby for years is about to be ended! we are no
longer going to be forced to silence on this filthy filth!
this filth so called movie
was the 1976 british entry for the so called cannes
film festival and was heavily, over man y years!?!, promoted by the bbc:
--and when i met
Barry norman we spoke about the filth called bugsy malone and He
very strongly told me that He thought it was the filthiest filth of all time,
but that in the in dust ry, the way it is, not surprising
considering the way the filthy so called men of the in dust
ry elite are towards YoungGirls: Barry said he was told what to say and
when to say it for years and that his acting skills and I quote: “had to get as
good as a forced Actress HerSelf”
--at least we know
what david puttnam and alan parker want to take to a desert island via bbc r4
circa 1984-1985! bugsy malone was men tioned on the
so called show!
we can also find out
what mel brooks would like to take onto a desert island via bbc
r4 and he was the filthy filther behind the pg bbfc certificated
filthy filth so called movie spaceballs! he also
told Barry norman in the 76 yearly review that he insists on bad
taste in every filthy filthing he does!
Barry told me he was
threatened by so called men who i can not identify that if he did
not include bugsy malone in his best of 76 review
that he would be killed, and as he over an extended period of time of Mammy
weeks refused to comply with this order: so Barry told them that He was going
to write something on this one, for a change, and after much verbal fighting
they let him and waited to see what he wrote : his disdain for the filth non project
bugsy malone was obvious in what he said and the 76
yearly review can be seen here, (see link file on phone barry norman 76) and as Barry said in this
review Jodie foster was 14 during filming!!!! but when talking to alan parker,
the filthy filther so called director, on film 95
he reluctantly admits she was actuly 12!!!! why did they initiuly lie and why
the change of information. guilty filthers! alan parker claims in this so
called interview he is embarrassed about this filth so called movie
(link to 95) EMBARRASSED NO LESS! : which is an obvious attempt to modulate our
thoughts to acceptance mindset of this filth ........ and when i PerDaughterly met
with Barry He told me He was told/forced by alan parker to go along with this
claim of embarrass meant before the fact as that was the plan for
his new position on the film! EMBARRASSED!
76 : https://m.youtube.com/watch?v=es-D0A5sn2Y&pp=ygUZQmFycnkgbm9ybWFuIGJ1Z3N5IG1hbG9uZQ%3D%3D
95 : https://m.youtube.com/watch?v=6MwmGzOQHus&pp=ygUZQmFycnkgbm9ybWFuIGJ1Z3N5IG1hbG9uZQ%3D%3D
how does a filthy
paedophilic filthy filth like this get distributed : how does it get
advertising and distribution let alone even get made in the filthy first place.
because there is a serious filthy problem throughout the groups of so called media
so called men of the so called film in dust
ry and its funding distribution and advertising and legal protection from non legislation non policing and judiciary
support via inaction: Jodie foster was actuly 12 years old and they lied about this,
so how old were the rest of the Girls they had dancing like prostitutes? this
serious paedophile problem obviously goes right to the top of the in dust
ry in the states and in britain : filthy shits!
there are so called men
in this so called world who think it is ok for any Girls who
menstruate to be fucked by them : so called men used to think
this way in the past and in certain circles this attitude has persisted : it is
passed down from father to son and from filthy so called man
to younger capable of filth indoctrination acceptance so called man
: these so called men sometimes come from traditional backgrounds
and want to pass on this tradition of filth of the so called men
of yesteryore : these so called men are depraved filthy shits and
they walk amongst you on every street in every in dust ry and
clearly have major influence in this filth so called world : this
is patently obvious in filthy filth filthers so called movies
like this being intentionly made distributed and advertised and certificated
as U and every filther involved not being arrested : filthy shits! in
1983 bugsy malone was given half a million pounds to be a west
end musical! by who!?! and it ran from 3 dec 2022 to 15 jan 2023 at alexandra
palace! and the daily telegraph called this filth criminuly good fun : the
financial times called it joyous : and this trailer (link file phone) has the song
bad guys written by paul williams thats lyrics are: we’re the very best at
being bad, we’re rotten to the core, we’re the very worst each of us contemptible
we’re criticised and cursed, we made the bigtime malicious and mad, we’re the
very best at being bad, we’re so rude its almost scary, we could’ve been
anything that we wanted to be with all the talent we had, with little practice
we made every blacklist we’re the very best at being bad, we’re the very best
at being bad, we’re the very best at being bad: clearly this song was written
intentionly by the filthers of the so called film in dust
ry to filthily goad the population of the english speaking
so called world -that know promotion of criminality is illegal-
as MammyGirls do not put up with this filth!
bugsy malone 2023
https://m.youtube.com/watch?v=FoRzW_dGN_o&t=26s&pp=2AEakAIB
i do not know how
they forced GirlyBubbaPeomple in 2023 to participate in this filth so called
production! ........
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
if we ever need to
protect ourselves i think we need to emsure the GirlyBubbaPeomple whom are
protecting us are not constantly off their faces on cocain and uppers
and downers and beta blockers !
what we are going to
need to protect ourselves from attack from space is very large space weapons
that null and void any need of muscley violenced wankers to run around shooting
peashooters at each other : though when stoned and coked up they theoreticly
find that fun : theoreticly : if they are sitting on their butts at home in
their easy chair : not sure how much fun drug addicts are having tbh
so if another species
in our vicinity wants to hurt us we are going to have giant Girly designed
space protections that no so called men get any where near! with
our bodys not needing to be in any danger : if our bodys did need to fight,
which i find absurd, then they could do this automaticly whilst we had fambily
times im mindlimk cuddle times im SyMomYouElatiom: we are to live TotAlly
without trauma With💖💖💖💖💖💖💖💖💖💖Her nil trauma nil
pain and nil suffering always allways: this is what Girls DeMammed! no pain no
trauma no suffering : no scrapes and bruises no skinned knees no bruises cause
bubbayou has fallen over no cuts on your hands no pain no crying no suffering
EVER!
that’s what Girls
wamt APlanetteEarthMother’sWoombyWoombyAGalAxyADuoVerseAMammyVerseABubbaVerse
completely free from suffering and pain : this is what GirlsWamt!
ANDTHEYREFUSETOACCEPTANYLESS! : if you can’t sidestand this then you are going
to have to learn fast! Girls do not wamt any trauma AT ALL! : we do not wamt
any trauma forced on OurChildrem : we do not wamt any trauma forced on amy
bubba of amy species not ome! EVER EVER EVER AGAIN! no emotional trauma
no psycho logical trauma no physical
trauma : yeah? bubbas do not wamt you to teach them to be fearful
of any thing and every thing like you are : yeah?
no fear no suffer ing no trauma.
THIS IS WHAT GIRLS WAMT NOW! leave our bubbas alone! AMBE WE ARE GOING TO GET
THIS PERFECTIOM.........
AMBE if any so called
man trys to stand in the way he is going to go to prison : case
in point is all you filthy filthers so called movie so called industry
so called men, whom think YoungGirls are fair game for your
filth, you are all going to prison once testimony is rallyed forth from the
GirlyGirls you have abused over the last century : AMBE ALL GirlyBubbaPeomple
Whom formerly thought of themselves as men are all going to be
FullGirly or stay in prison until they learn to be so.
if we did have a
future conflict with another form of life then only older people could be
cognisant of the problems going on as we could not wamt amy younger
girlybubbapeomple to be tainted by amy under standing of violence.
intentionl tainting
of utopia mindset by filth fiction projects of filthers so called men
to somehow prove we would be weaker if we give up on our violence and
aggression shows so called men and their refusal to give up on
small pathetic weapons war meantly : path thetic it is (not)
we do not wamt the so
called minds of men (they do not care!) ruining our
first comAliKissySnuggle with another SuPramBubbaSpecies pa thetic
ick
514 :
whenwalkingdownthe/whensteppingontothe street it is very rude to walk out in
front of GirlyBubbaPeomple and split them up from each other: if a couple are
together you cannot walk in between them : just wait politely ambe they cam
carry om im their GirlyNestyAliKissyCarolineSnuggleJoyDreamsyNestMoveMommed
AMBE you can reflect your ImmerShimmerGlimmerGirlYummyLummyNYummy.
💖💖💖💖
OO--1O2—OO So Im
Being The XeroLove Of Their GirlyNestPartMa All YouGirlyGirlsGirly boys
Earn The Rights To Be In A Relationship With One GirlyPerDaughter........We Are All Am PotentiElla Multitude Of GirlyNestKissclusive........We
Are All Feminine Amd That Is All We Can Ever Be, AMBE GirlyGirlsGirlyBoys Realise This LoveProof: That The Nurturing Nurture Of GirlyReality Is All
We CaN Ever Be........AMBE TheM GirlsLives Are To Move Along Happily For EveryDuo........
💖💖EmergyMoveMommeds💖💖
💖💖AMBECheekKissing💖💖
accepting
girly bubba peomple being more outwardly emergetic with their body
movemommeds with their girly talky handdancey hands gestures as they girly
talkytalky : acceptance of everybubba living this freenesty lovelove being
nice ambe emergetic : Shes is serious AMBE niceynice if duoGirlsdanceytalks
about everyyumbyumblovelove with danceygirlychoreofunfun
jigglegigglewiggle commummycatiom all day long
everyHere : bubbas love too kissperiemce their movemommeds im
positive uplift happynesting flowy dresses Twirly shiny blouseys
Swirly glittertightsys Whirly ALLBubbasDancesGirlyJoyJoy
as they have every comVerseAtIAM of their girlynestyjoysLoveLife
DefinitelyInDefinitelyThat
Kissing Ombe Cheeks Love Is Greetings Repletings Meetings
If You Have Hab A SpeciFussyFussyFussFussComVerseAtIAM Ambe I bubbalOve You
Kissing Me Om My Cheeksys With YourLips So You Cam Ambe AirKiss Or Delicate
CheekBrush Is GirlyDifferemces Preferemces That GirlsImSistermces Upom Are
Always Joy Loved Now With KissCeptiom choicesabubbasowmlovestoloveGirlyKissclusive
: am air kiss with am cheek to cheek is yumyumnice or am airkiss with no cheek
to cheek we allBubbaGirlytalkytalkygirlybubbahandsyswirly about this :
GirlsysDuoPartMasPreArrangeAllTheirGreetingsKissesArrangeMommedsWitheveryOtherGirlyNestGirlestGirlDuoBeforeTheyEvemKissForTheFirstTimebJoyJoy
WelcomeToTheNewGirlImSistermcePlanetteEarthMother’sWoombyWoombyOfEveryBubbaGirlBeingHappySparkleDressStyle
ambe lipglossy cheeksy brushes are specialtalksytutu girlsysdecidetheirowmniceyniceniceGirlyNestPreferemces
: specifussygirlsytalksysarelegimommyingessemtiElla : our mindlimksistertermb
cam reminb us of whombubba likes this ambe whombubba likes that : girls like
girlybubbanestlegimommyingthatsmileysunshineyellowdressymummys’kissesAliCarolineKissySnugglesBothGirlyPartMasHappyTwirlyGirlySwirlyWhirlyLoveDuoLesboGirlyLove
girls like to talk about sociella lovey kisses
not about how so called men prefer to fight each other fuck Girls
and kill innocent bubbas
we have to change the
present : its not possible to go back in time and change our childlives and
change the way we grew up and and all the negatives surrounding that the
negativity so called cultures the negativity so called men
tal ety : it is not possible for us to go back in
time and do that : but waht we can change is the present : all our present
behaviour is based on cause and effect : all the negative environ meant
that’s been around us has created our mindsets today so now our behaviours are
a response to that are reasoned are force d by that and we are
not able to creatiomEllaise differemt choices other than the way the so called world
has made us to be : we do not want to be be made to be or do any thing
we wamt to be able to be born AMBE KissLove The GirlyNestyWorldyPlanetteAerthMother’sWOOmbYWOOmbY Im A Lovely
Way as per our girlsydreamsywishes : this is what we girlsyneedynesttodo
whem we girlyfyEveryYumbYumb to where we need bubbalove to be
we have to look at our behaviours : we have to look at how can we help GirlyBubbaPeomple
get over their trauma : people don’t accept it as trauma : all the experiences
we have had are trauma based because this whole so called world
is trauma based : virtully every thing in this so called world
is trauma.. even nice things that happen to us are inevitably all with
in con text / sub ject to / result of /
corrollarised base d on – trauma : of a masculin murder
rape torture so called world. a
masculin murder rape torture culture.
And to get over this stuff we all have to recognise that we were
all born as babys and that we all are innocent : every single ome of us : all
the horrendous things that have been done to other species, rape
torture murder for years and years and years, you are all guilty of that but
you do not recognise that : every thing is trauma base
d all from sur vive al (sir
viva (one L ‘all’ equals just so called men)) from
trying to sur vive (hail to the hierarchy) and its all been trauma based, tribal trauma that so called men
carry into the future : all so called mens present behaviour all the behaviour of so called men at
the mo meant its all trauma based and its
all from this his story of trauma that our fortMothers have had
to go through and now it carrys on in the filthed so called minds
of so called men : amb alll those girlyreactioMary culturElla nor
mals are still here ambe are never going away : whem Girlynest criticises
filth so called men Girls are not playing they are deadly serious
: whem they tell you in no uncertain girlyterms they demammed you to be actressing
nicely at all times to EmSure you permamommedly change your filthy behaviour to
GirlyloveLoveAliKissyCarolineSnuggleSnuddleNuddleCuddleGirlyMummaBubbaSisterDaughterPerfectiom
: it is very positive for us to all explain to so called men why
we are all are where we are, where all this behaviour comes from, and explain
to so called men that its there/their behaviour and
they they themselves are wonderful ambe perfect ambe bubbainnocent ambe it is
not them that needs to change just all there/their behaviours that they
have been traumatised by and they now traumatise others by : that’s what needs
to change : ambe if we change that them we change the way girlybubbapeomple
feel about us as people , them the so called world moves further
forwards : it is very difficult for people to not criticise people di
rect ly : we need to shift away from blaming a
perdaughter specificly or even blaming : so called men are all
babys : their all babys : whenever I write an idea down i try and look
at the behaviour and and that to be my focus/feelingsy : it is not necessarily
easy , it is not necessarily possible to always cuddlethisfeelingsy because of
all the trauma that is going on in the so called world : you
could easily look at this from the perspective feelingsy
of the behaviour being at fault and the perDaughter being at fault and hold a
superpositional position on this as in both those both those comcepts, thought
about im love, With💖💖💖💖💖💖💖💖💖💖Her a comceptuElla
GalAxyEmotia they could both coKissSist because Girls are so angry amb upset
about the way the so called world is : so girls look at the behaviour and say
feelingsy the so called men cannot behave any other way and at the same timeb
they need to change and we need them to understand that they need to
change : so they need to understand that their behaviour is
unacceptable : it is their behaviour that is unacceptable, but we are not
saying it is their fault as they were born babys : we are not blaming them
GeMeticAlly or SapphysiaEmotiomAlly, we are not blaming them because of their
ethNiceity : we are not blaming them because they are a so called man
(all are Girls) but we are blaming the behaviour of so called men
and the so called culture of so called men and the behaviours
of so called men for all the problems im
PlanetteEarthMother’sWoombyWoomby : cam we Kiss that superGirlyposeishIAmAlly
amb still blame the perDaughter so called men are trulynestynesting TO BE : the
perDaughterTwirlyWhirlySwirlyGirlyYouTrulyGirlsyDreamsyWisheyNest TO BE : the so called man whom
was born as a girlybabyofmummas’tummachubba : there is nothing wrong with YOU
: AMBE we have got to get the girlyFeelingsyImAllYourHeartsLoveThis :
bubbatimeb : ambe we need GirlyBubbaPeomple to Know That It Is The Behaviour
That Needs To Change AMBE the way YOU are YOu cam start to be very friendly
ambe nice ambe comalikissycarolinesnuggle to all the
GirlsOfPlanetteEarthMother’sWOOmbyWOOmby : you are a baby whom was born
girlyperfect, a perfectgirlyImMomSentbubbababychubbatubba : ambe she is the
real You of all of You : You who is imclusive ambe Loving ambe wonderful ambe
beautiful : all bubbas are beautiful : ambe cuddly ambe perfectly
yumbubbayumbubba ambe kind ambe ComPassioMate to everyduobubbalove : all girly
perdaughters formerly known as men : this is the real you With💖💖💖💖💖💖💖💖💖💖Her OurPlanetteEarthMother’sWOOmbyWOOmby
GirlyIsTheRealYou! AliDaughtersCaroline SheIsTheDefinitiomEllaOf NurtureBabyGirlsBeLovedCuddleSnuddleNuddleBoobsyLoveElle
GirlsNeedyNestFussyFussyFussFussGirlyNestAllAreGirlyBabys
: all our babys are perfect pure babys ambe we all wamted all our babys to grow
up to be Omederfull amb kind amb comsidematernAli : She Is The LoveNest
We All Are : im the depths off our girlyhearts we all are :
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
but our behaviours
have been skewed by filthy filthers and mal formed (can we say mal
formed?) by the fact there is a filthy imbalance in the so called world
: now no balance is required in fact the never was a need for balance as masculinity
never KissSisted im the first Kiss : Femininity is all that ever was ambe we
are all girlybubbanurturersbubba ........ KissclusiveKissKissive :
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
we can’t blame GeMeticElly
because we have all been sub ject to nefarious/negative communications that
have been un soli cited : we can no longer be
expected to cope and speak and constantly be forced to reference our behaviour
to trauma we counldn’t avoid as we were alone : we can no longer be alone : we
can no longer speak alone : we can no longer be taken advantage
of because we are segregated by so called men and their greed and
rape prostituition filth indoctrination.
For so called men
to think solictors can be called solicitors and prostitutes are involved in soli
citation is proof of the rape men tal it y
(we wamt this his story gone.
We Can Say Girly-Formed
Omly GirlyFormed ForEver........
💖💖💖💖
OO--1O3—OO WE Need To
PoseISheIAm OurSelves TooWards
Love (Umb) We Need To Move TooWards Love (Mumb), Ambubba Omce We Do That We Realise That We Earn The Rights
To A Fambily........Fambily Becomes A Reality Not a con mod
it y: If we realise that once we move TooWards Love (Tumb)
we realise that Femininity is
EveryEvery........Femininity Is Reality........Femininity Always Comes
First........Girls Always Come
First........AMbubba Once We Realise That We Realise That GirlyNess Is Primary, Then We EarM The Rights Too Fambily........AMbubba
If You Kiss A Fambily Or Not, Omce You Move Im The Correct ProgressiomFashiom
TooWards Love (Chumb) You AliKissyCarolineSnuggleStand
That Fambily She Cam Be Your Reality........She Cam No Longer Be A con
mod it y........
progress
491
fambilyschoolssnuddlenuddle
KissTemsiom OfFamily
Respect To Friends
Adoptiom Of Friends
Into FamilyLAW
FamilyEmotiom
IsToBeProtectedFromUnacceptable taint and the reasons for non incest are not
just BiaEmotiomElla They Are PsycheSapphoesticPhiloSophiaEmotiamElla
AudioNote 201
arranged marriages
within certain ethnic groups.
arranged marriages
driven by fear of filth and fear of congenital problems from within a community
modern filth culture
forces familys into fear and panic and closed and so called conservative
viewpoints: turn that filth off tv baywatch.
violence and fear to
keep children in line. closed communities: closed extended familys and
communities: gradually accumulated congenitive semi incestuousness (when
people who are too close GeMeticAlly in a local area from different fambilys
have children) GeMetic problems driven fear of filth incursion into extended
family cuddles. we need to think of too close GeMetics as non acceptable and
equivalent to incest with new legislation: bubbas being informed of GeMetic
Familiaritys when young to prevent unacceptable Love: why do we still not have
a GeMetic database for everyone : we can acquire dna from bedclothes of you as
a prisoner in prison because you refused to do a mouth swab : so called men
want to be able to get away with crime from the past and present : all GeMetics
is to be accurately kept on file.
fear of children
being driven to drugs and one night stand rape and the rape culture of dating.
it is fear that drives Girls to date as
multiple people to try to find some3one nice in a so called world of masculin
filth promtion no one is suitable so Girls settle for
something, anything they hope is a symptom of love ...
everyone is
aesthatically beautiful.
lust is not acceptable until you are already eternally committed
to each other
all the reasons
people have felt this fear have to be removed: fear of social
downfall, destitution, childrens minds being filthed by filth rape culture and
violence culture and drug culture: affluence for everyone and ethics across all
communitys removes all pressure from parents. full removal of all religions
removes social pressure.
💖💖💖💖
audionote 206
time dilatiom as a
reductiom in emergy of a type like dark energy etc.(not time herself but similar
im kissyeffect?)
incorrect terminology
application
OO--1O4—OO
CauseAmdEffectLoveAmdCuddle Chains Im Theory Cam Effect The Way We Think Amd
What Happens, Um, I say Im Theory Because I am Talking About InfintessimElle
Cause Amd Effects Which Happem In SubStratums Of Reality, The Possibility That
Within Very Small Realms, Of SubAtomic Scales, Where You Can Potentially Have
Cascades Of Imformation Percolating Upwards Through Levels Of Scale Um For
Instance If There Was An Altenate You, An IdenticElle You, Who Was Doing
exactly the same things as you because everytrhing in those Two POV Bubbles has
been lined up identically and you were basically living the same life, But In
Another CuddleArea Of Reality, One Of Of An Infinite Number Of Identical Yous
In Identical Universes As Reality Is Potentially Infinite In Size, In One Of
Those Universes Despite Everything Being Identical There Could Be A Slight
Difference On A Subatomic scale or even on a far smaller scale than that that
could potentially cascade upwards, amd if it could create enough of a wave of
influence, of cause and effect influence, it could potentially effect your life
and thinking to creationalise a different decision........
softy softy moulding
and printing instead of hammering anvils and steel presses for respect
innannarealms cascades: loving placemommeds instead of forced obedience: all to
be respected as awareness of awarenest. the ergonomics and emergy reductions
are obvious but not the main reasoning as ethicElla love is always the main reasoning.
steel foundrys waste vast amounts of heat as men refuse to heat
capture and recycle: softy softy combined with fully insulated recycling Girlyplants as Girls are calling out
for are to stop filthy murderous policy wasteful fuck you jack iam alright men
are to be stopped. men stop better steel foundrys from being
established so they can continue to burn and waste and over charge for no other
reason than filth tradition and inability to change.
audionote 202

Girls Need This reality To Change For Them. They Need That
Difference To Grow Imto A MoveMommed Of All Cuddlimg TogetherNest That Sees The
End Of Masculinity.
💖💖💖💖
492
💖💖💖💖
OO--1O5—OO This
Change Has To Happen Via Emotiom Of ComsciousNest Um, Our Mind Is A Product Of
PhysicAlity Of EmotiaEmergyMater SisterTerms But Our Mind Ultimately Whilst
Being Of The Physical Is ElectricElle Im
Nurture Amd Very Sensitive........These Sensitivitys Are For The
EmCherishMommed Of GirlygORGEOUSGirlygORGEOUSGirls
💖💖💖💖
OO--1O6—OO Within
certain POV Bubbles, The causeamdeffectLoveAmdCuddle loops that
surround you, your causeamdeffectLoveAmdCuddle loop amd other Peomples, they are all imterlimked,
amd they all have to be of FemInInity........Girls Want To Be The
Change That ReBiverts Our
Love Towards Nurture. A Resolutiom Of
Change Amd A Removal Of The Need For Girls To Utilise Tolerances........
The resolutiom of
differemce That Is Required Is For Girls To Decide, To GirlyEmSure EveryEvery Happens
Differently AMd AllRealityMumma Is SnuggleCugglyBugglyWuggly
To comsider a change
could occur in a universe, even a minute one, we are comsidering the
possibility that a change in causeandeffectLoveAmdCuddle is
even something we can talk about, which comsidering an Infinite Amount Of
Peomple im the future will never live now because of one small change cascading
out across all Reality, we are theorising for fun upon the effective deaths of
an infinite amount of Peomple. The way men have unEthicAlly
theorised for generations with disgusting Hypotheticals........ theoretical
scenarios is something Girls want brought to an end because even mentioning
death is something Girls do not like.
493 game = murdered
GirlyBubbaPeomple. games are filth murder torture death rape promotion pro
pa ganda
children taught nil
violence as in they are never ever exposed to any violence or unpleasant
talking have no con cept of violence or aggression or even a
disagreeing sentence (acceptance of tom and jerry is widespread
murder) because they have never been taught this way of thinking : every tv
show on tv is about promotion of disagreeable and promotion of violence overtly
and always in subtext : every filth that is watched on tv is designed to
indoctrinate children to agression and violence and its acceptance: all
computer games are the same, about destruction and harm and violence and mind
filthing : and then so called men say there is no link between
violence in everything and violence itself: and they deny the fact that nice
toddlers are having their niceynicenice character ruined everyday by masculin
violence mindset forcing indoctrination syllabus and teaching methods in
torture instituitions also known as schools: stop training Girls to filth
acceptance in schools: 494
495
496
498
499
500
audionote 324
beepers do not help deaf
people but bright flashing lights do that could be a disturbance too
audionote 326, 327
💖💖💖💖
OO--1O7—OO ABUSAGE OF DIMINUTIVES POSITIVISE THIS PASSAGE
AS MUCH AS POSSIBLE
Girls As Diminutive insults: audio note 108 (do we have this whole chapter in littleones)
Dimunitives as
insults, turning any word into a diminutive is what men like to do,
theyll take any word like lad or boy, turn it into a diminutive into an insult,
anything that means something small will be an insult, the whole concept of
referring to someone or something that is no good in the eyes of an insulter to
something thats small, and assuming that something that is small is no good,
this mentality has to go its disgusting, even the word mentality
itself has to go comsidering it has been used to describe people im negative
ways.
audionote 237 -241
continued from
audionote 241: the finer point being they cannot go around suggesting indecency
and laughing about this and ssuming this and telling jokes about this. the way men
have told incest jokes for generations is absolute filth and they are going to
be stopped PermaMommedly
Theres something
wrong with being Young, Small, a Girl, Girly, Have Different Interests To Someone Else Meaning A
Different Experience Spectrum (knowledge In Different Areas). men
cannot bear to be in a position where they might learn something new as the social
pressure of not having knowledge on a subject is perceived erroneously as a
weakness to bully.
You can be a Lesbian if you like Boys
too........the removal of exclusivity from value attributional of what will
become upom full LoveyStuffs
a new Loveage
of KissyStylimgs.........Liking Girls is Lesbianism amd liking Boys is
Happynessism amd this as mutually reliamt amd mutual needyness fostering
FamiliElle........
GirlyfyedGirlyFemBellaLoveyFemininiGirlyBubbaPeomple –
FemBellaLoveyFemininiGirlyBubbaPeomple --
SymboLogicElle – referenciElles are CoCuddly - Thinkages Thimkages ThLimkages
ThinkingThetacleLimkages. (HyperThetaCall 8, Circle Digit, Equality Love, GirlyForeverness See Image)
ModElle, ModeElle Limkages (modal) (see ModeEllities) no more widespread social
semsuality en force ment, but BubbaReality
Immocemce Cuddly AllImclusivity.
Observing within the DuoVerse the pattermisatioms of
LoveTruth of the
AllMotherimg ImHeremce Of GirlyReality.
FemMeter88 Numbers – 3 dimensional
EmotiaEmergyMater
Self derogatory interaction to be banned
audionote 242 243 244 politics kills more people
than war.
Diminutives END
audionote 265
gemeticella legislative reform
DIGNITY FOR ALL
SPECIES
Plants can’t be
expected to put up with physical assault. mutilations and murders are commonly
thought of as acceptable: Girls wamt the
protectiom of all GirlyfyedGirlyFemBellaLoveyFemininiGirlyBubbaPlantsBubbas
From all forms of physical attack: touching plants is unacceptable and the very
wind blowing against their bodys can no longer be accepted: this is physical
assault upom those whom have to have their bodys respected to the highest
levels of GirlyFemiaFemininiFeminaLegislatiom Regard.
Flowers Are Genitals
Amd The Genitals Of Other Vulnerable People Can No Longer Be Used As ana logy
For Anything. Flowers Are The Genitals Of Peomple Whom Need Respect Until They
Can Creatiomelleise Their Owm Decisioms. Until Such A Time All Plants And Their
Genitals Deserve Dignity And Need To Be Covered. Only Peomple Whom Voluntarily
Walk Naked Within PlanetteEarthMothersWombyWomby Can Show Their Bodies Amd The
Rest Of Our Bodies Are No Exception. It Is Difficult To Decision For Others
Upon Their Bodily Exposure Choices. So We Have Serious Comsideratuions Upom Our
EthicElleity To EmSure Correct LovimgKisses Are Allways Im Place. Trees Amd Plants Prefer To Be
Warm Amd Clothing To Provide Them With Dignity Is An Option But Also They
Prefer Light So Comsideration For Their Privacy Amd Private Dignity Is
EssemtiElla Going Forwards........
Cutting off the
genitals of Plant People for our own pleasure. Sexually abusing Plants by
inflicting sexual abuse upon their amuptated genitalia is absolutely
disgusting.
Cant take pictures of
plants without their permission!
EmSuring Flowers Are
Healthy With Automated Systems That Are Not Abused By people to voyeuristically
pleasure themselves with images of plants private parts........automated
systems that are to EmSure that all parts of plants are in OptiMElla
Health/Sustenamce CuddleKiss even the most delicate cold or dehydration
susceptible areas of their bodys that are not our business to disgustingly
ogle........
in the same way Girls are abused as
something to pleasure a man, flowers have been used and abused by so called men
commercially to symbolise this very subjugation abuse and the correlation is
disturbing (Girls don’t want you talking about flowers as vaginas or
correlating this to their own vagina or talking about their vagina or any
vagina per se: shut up you filthy filthers)(a kiss and a cuddle does not
suddenly vali date your non existent rights to
suddenly start objectifying a Girls bits or envisaging your access to Her Vagina
as imminent. it can take years to earn this Her Love : years and
years you filthers!). so called men look at Girls as they wish at
your Girl as they wish pleasuring themselves in their minds to bodys as
they wish in public places surrounded by the general public with children
present, and plants are treated with the same disdain as their genitals are
offered for sale for profit then given to Girls that men
want to act like sluts: if this doesnt change yesterday Girls are
audionote 198 
acquisition of drugs
from plant: synthesis of drugs not found in PlanetteEarthMother’sWombyWomby as
in the Bodies Of Other Peomple (plantsetc.)We Need To Not Need Drugs
SeeHealthCare
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
🌈🌈💖💖🌈🌈
🌈🌈💖💖🌈🌈
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
💖💖💖💖
Flowers Are Not For
Us to disgustingly ogle.
💖💖💖💖
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
🌈🌈💖💖🌈🌈
🌈🌈💖💖🌈🌈
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
They Are The Private,
Delicate Parts Of Loving GirlyPlantyBoos Amd Must Be Covered Respectfully........
impossibility of
continuation of abuseage of momlecules acquired from plants for any purpose (all
drug use from plants is paedophilia as plants are raped children, and any
momlecules structures of non essential foundatiomElla Life essemtiElla GirlyShapes
that are designed from knowledge of : inspired by structures of : plants : for
any purpose, is also paedophilia) and drugs are to no longer be needed and disease eradicated and any
further duopolation of momlecular research has to be ethicella: we need to
developmommed protective technologys that nullify the need for momlecular
protectiom with her our bodys from any form of biological chemical or atomical
attack on our biaemotia: we need to think bigger and safer and realise lots of
tech is non able to explore non needed defunct though devleopment
desigmateyomed by Girlynest.
audionote 385 plants
getting raped and correct ethics application:
💖💖💖💖
OO--1O8—OO
💖💖💖💖
OOO—109—OOO GirlyEmotioms
Im GirlySciemce Being The Unifying Theory required in science to
bring all theorys together Um A Theory That Girls had already envisaged imagined amd created in their Dreamsy
Wishes in application to science until they moved into those circles and had
their GirlyNess Neutered by men and their lack of emotion
approach to science which is a massive problem........I don’t think we can
really complexify our thoughts on science to the maximal MaxiMummy
Degree Umtil We EmotionElise Every Theory Amd Every Comcept, then we are going
to come up with new ideas........People with less science knowledge but with
ethics can find ideas that people with lots of knowledge are overlooking,
intentionally so at times because they are biased against emotions amd
CompashLogicalisimg, although they might not theorise it that way, if you know
what I’m Sayimg........
Amd This Sort Of
Speculative GirlySciemce That Prioritises The Looking In Places That Are not
convenient or that raise EmotiomElle
worrys, is not the kind of conversations that are to be held in public arenas
of EmotiomElle susceptibility. We need to
move beyond the any topic goes assumptive that has ruined freenesses of speech
since the advent of lamguage........
We Can No Longer Have GirlyfyedGirlyFemBellaLoveyFemininiGirlyBubbaPeomple Getting Upset Ever........
Intentionalised
Awareness Of Infra PotentiElle ImFlowemce Of Motherisatiom
Unintentionalised
Awareness Of Infra PotentiElle ImFlowemce Of Motherisatiom
Maybe All Infinity
Follows The Same EmotiaEmergyMater MotherMaticElle Amd That Is It? Maybe Thats
The Only Way Emergy Cam Arrange Herself.
universal symbolic written form that everybody
understands: all children of all species are taught to write this
Notes for placing:
CommunicatiomEstablishimgCuddles
BiologicalCommunicatiomElleKisses Are The Needynesses Kisses
((Comsciousness
Is ElectricElle KissperienciElle, ElectricElle
KisspeerienciElle Awareness Of Differimg MorphoLogicelle
Functiom Factorisatioms Amd Forms Of Complexifyed ElectricElle
ImterEmotiomElleActivities MorphoElectic; Amd The Propemsity Of ElectricElle Awareness
Morphs To Be Generative Functioms Withim Reality Mater
Substrates Im Feedback Functiom Depemdemcies Has Potemtially Had More Of Am
Effect Om The Complexifycatiom Of EmotiaEmergyMaterSIsterTerms Tham EmpiricElle Assumptives Presently RatiomElleise.))
383 and 384 422 car
safety in flood waters
edited version in glossary (in grey)
Mansplaining --
Actually refers to men explaining things which are actually bad
and trying to make out that they are good. mansplaining
should refer to men explaining bad stuff as being good which will
always be interpreted as sexism because this world is just an overtool by which
to dominate and control Girls and otHer
Species. The survival reasoning is now defunct and men must
realise they no longer need to be in fight/control mode. In and of itself this
term is inHerently sexist as it is designed to cause offence to one Gender. I
do not believe in insulting words as I think they are disconstructive. I do
believe that this term is a result of Girls using their justifiable right to fight back against
the disgusting sexism of man in desperation. And of course man’s disgusting
behaviour of demeaning and patronising on compassionately logical topics or mansplaining in his that’s the way the world
works wont in support of sexism and murder and rape or any negative explanation
at all as they always lead to sexism and murder
and rape would potentially need a stronger term than mansplaining maybe?
CosmoLogicElleBeingismPathology
– super nova
Pulsars (protection of Planettes Amd
Momlecules Amd AtMomic Bubbas)
Black Holes
going backwards in time a blackhole
becomes a whitehole, amd a whitehole (non escapable event horizon that emits
photons) becomes a (non traversible event horizon) blackhole that emits light
amd traps light too........ Reverse Pole Lovity
every blackhole is a whitehole that
can only be viewed by GirlyMummaReality
on the opposite of the blackhole to an observer........observer
comtingent/comtangent
💖💖GirlyBubbaPhotons💖💖Are SissyGirlyNestEmergy AMd
All 💖💖GirlyBubbaPhotons💖💖 Are SissyCoMummycatiom CommunicatiomEllaisticAllismsSissy ComMummycatiomSissyAliKissy:AllSissyEmergyIsSissySuch........SissyEmergyIsLove AMdSissyLoveEmergyIsGeMeticEllaFidelity
JoyComMummying AMd AllSissyDefinitiomElleise As EmotiaFidelitySissy AsComSisters AsComSistermce:MateriEllaAMdEllaNurtureLoveAllwaysAlways SissyAliKissy ForComMummycatiomLesboSissyFidelity
OriginalText
(PhotonsAsEmergyAsCoMummycatiomCommunicatiomComMummycatiomEmergyAsTheseAmdTheseAsEmergy(Emotia)(ComsistersAsComSistermce(MateriEllaAmdNurtureLoveAllwaysAlways)AmdComMummycatiom)
Notes For
BioLogicElleEthics Below
Ethics Of Hair Follicle Non Damaging
Size Reduction
Hair Colour Change At The Follicle/GeMeticElle
Stage Or Hair Colouring (Hair Colouring Needs To Be Safe, Outside
PerDaughterGenomicChanges?)
RIGHTS OF ORGANELLES TO THEIR LIFE CHOICES AMD THEIR HABITUAL COMMUMMYCATIOMS AMD
LIVING AMD LOVING KISSPERIEMCES
some could stay if
they were happy to KissSist within the
ParaMaters of collective AwareNest
beingism but some may wish for more independent KissSistermce
amb they could leave if they wished for a dom icile of their
choosing........ (hom = man : dom = filth
: home (english) dom (polish)
: we can see the thinking here from the so called men of europe :
i am criticising all so called men of all nations
but i am most definitely not racist : i have two half Polish
Childrem)
continued
physiologicElle integrity Organism (we cant be expected to suffer in any way
including psychologically
rights to different
life experiemce Organelles (initial communication......changes in circumstance)
by giving them communication we could also be giving them suffering. rights to
non interference and choice of all physical imteractiom some of which we can
classify as communication
does our right to
self comtinuation mean we wont try to communicate with organelles. we have to
listen amd emsure no suffering goes on. if they do suffer but we still think
communication is not possible because our need to perpetuation at least in the
meantime, we would still have to figure out a way to only not alleviate but
totally remove all suffering.
End of notes
The ComSciemce ByMammycism
Of Reality’sGirlyCuddle Is GirlyHeartsyCuddly ImterMamsiomElleisticElleisms Of GirlyBoys Beimg Finally What Their Girls Need. Girls Need Feminine
Thought Amd SociElleGirlyOutFlourishes From All GirlyBubbaPeomple Of
All Gemders. There Is To Be GirlyNessPsyche Withim The MindKissScopes
Of All Girls Amd Boys Amd All Reality ComputatiomElle
Cognitiomismg Emotia.
This Part Of The Project 💖💖Births💖💖 New
Terminologies Amd FeminisatiomReCuddles Of
Lamguage As Am Attempt To Help Girls Feel More Comfortable About Listenimg 2 Amd
Readimg This FemininiProject In PreParation Of GirlyLamguageReforms Durimg The
The Girls Girlyest Of Girly Full GirlyFeminisatiom Of GirlyRealityGirlynessKissyCuggly........
For Details Of The GirlyVocab Utilised To EmCuddle
Our Dreams Withim This Project Please See The FullGirlyGlossary Below........
All Ethics Is Is Feminism. If Ideas Are Not Feministic, Then They Are Not GirlyFemiaEthicElle And
They Are Not Ideas. All Philosophy Follows Feministic
Precepts........Amd Any Notions In Opposition To This Cannot Be Considered, Amd
Cannot Be Comsidered As Notions, Amd By Duopolation
Cannot Tangibleise Imto Motiom........Ideas Themselves Must Always Be Girly Im Comceptiom
As EveryEvery We Are Amd Aspire To Be Is
Of The GirlyestGirlyKissyJoy🌈🌈💖💖🌈🌈
That’s What GirlyKisses Are All
About........
Just How Mamma Always Wamted........
🌈🌈💖💖🌈🌈
🌈🌈💖💖🌈🌈
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
m m Mamma
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
🌈🌈💖💖🌈🌈
🌈🌈💖💖🌈🌈
YummyYummyYouYouUmmyUmmy
– Also Known As Her “GorgeousPonderBliss”
I Stand And Stare At
My Wife’s Puzzled Face As She DreamsyKisses
Im Her Mind What Wallpaper She’d Like........We Spend Hours Im Shops As I
Admire Her Um........The Gorgeous Way She Takes All Day Deciding What She’d
Like........This Is What A Man’s DreamsyGirlsyWishes Are Cuddled By........All Femininity Of Joy Is For My Kissperiemce To Be........That Lovely Little Frown
As She Comsiders Her Purchase For 5 Minutes As I Bask Im The Joy Of Holding Her
HandBag And Bags........The Look Of Kisstemded
Decision Kissimg Is The Most Loving Feeling A Man Can Ever Feel........Joy Im TheUmmyOfYummyMummyKissyJoy As That Look Of
Pondering Is A Gift For All Ages Of Infinite GirlyKissyFun........She
Has All She Ever Wishes For Im Am EmCherishMommed
Of ForeverFeelingsyFemininityFurrowedForeheadFlirty Cos She Knows Ive Been
Staring For 8 Minutes At Her GorgeousPonderBliss........
See -- DreamsyGirlsyWishes DreamsyKisses “GorgeousPonderBliss” EmCherishMommed TheUmmyOfYummyMummyKissyJoy
GirlyKissyFun ForeverFeelingsyFemininityFurrowedForeheadFlirty
CHECK VERY SMALL
NOTEBOOK PAGE
CHECK SMALL NOTEBOOK
AUDIONOTE 349 350 NotesWaiting
(CauseandeffectLoveAmdCuddle makes
it impossible to have freewill, but one could assert that part of
causeandeffectLoveAmdCuddle is our freewill, as in cause and effect chain
mechanisms are partially composed of our free will.)we have to help each other
to break through these cycling causeandeffectLoveAmdCuddle
negativitys
PREP FOR DUOVERSELLE GENERASISTER LESBOGENERA
Fictional problems
with storys that are People going to new realms as new realms if unknown are
stress points in narrative, like infra realms, for us to go there it would be
an unknown, unless we could look before we go amd search for somewhere nice
(could we help realms that weren’t nice?) to GirlyEmSure no stress for ourselves within a story, amd in reality we
are obliged to help People if we know they are in need. For infracopic realms
to move into our realm they would not be able to precheck to see if we are
nice........to do so they would need to be able have an area scope of vision of
such a size on their scale that vast areas of their strata would have to have
instantaneous communicatiom abilities just to analyse the data as sending a
communication device would be too dangerous for the recipient realm as the
senders would not know the nurture of that reality or whether it could handle
the EnergyMaterBynamic of any Girlymaterielle that was sent.
If People of such an
infra realm could see into our realm what would they think of our Ethics?
tHE aWE iNVOLVED wITH
aCCESS tO aN iNFINITE sEA oF rEALMS iS tO bE eTHICaLLY cOMSIDERED, aS mANY
pOTENTIAL existences would need ethicElla help not for us to be awestruck or take advantage of their
situation........amd we look to fictional realms with the same ethicEllaity
and refuse to be awe struck by un ethicElla possibility and even question the validity of awe itself, as
in awe has hierarchical connotations potentially buried in joy.......all
femininity needs the hierarchy extricated from awe, i mean joy........can
hierarchy be extricated from awe is a question? joy cannot be averaged off but
must become average kISSpERIEMCE (On All Horizons) REDRAFT WITH BIGGY ONES AMD LICKLE
ONES
GIRLS ARE NOT ATTRACTED TO masculinity
Girls are not attracted to masculinity, that is why
so called men hide it. the way so called men behave
when they are with other so called men being masculin,
being themselves. so called men are attracted to this
abusiveness.
Girls Are Attracted To Femininity As In Girls Amd Boys Whom
Act Soft Amd Gentle Amd Loving For Their Girls, In A Feminine Style.
and so called men
themselves are attracted to masculinity which is something that Girls really do not
like. So so called men force each other to be homosensual in
behaviour as they seek out and prefer masculin company, the type
of company Girls find disgusting. masculinity is unpleasant and
violent and bullying and rape culture supporting in nature, objectifying of Girls and Children
and everything. Many homosensual men whom actually present
themselves as being homosensual instead of pretending they are heterosensual
like virtually all so-called hetero men do, are not attracted to masculinity,
they are attracted to the same softness amd Feminine caringness that Girls are.
Homosensual men whom like nice kind men are like
All Girls. All Girls like nice kind men,
and they either put up with the knowledge that you are homosensual, as in
prefer the company of men acting out filthy disgusting masculinity
interactions, or they get rid of you as soon as they can, which is preferable.
The real you needs to be soft and kind……..there is no room in the Heart of a Girl for the alternative disgusting you, which is why you hide
this behaviour. This is living a lie. You are lying to yourselves about your
true nature. And this true nature is to be excised from all GirlyMummaReality. so called men are to stop being masculin
or go to prison. Girls like nice walks, shopping, and nice talks, and cosmosmetics,
and Living Their Lives With The Knowledge That There Is No Alternative rape
promoting, bullying, disgusting behaviour you that s actually the real you.
This turns the Girls off and they want it gone.
Your GeMetics are not
the problem. Your behaviour is the problem. The synapses in Your mind are the
problem: as in they need to be added to to reGirlyfemiafemininifeminacomtextuEllaise
you mindkiss to mummylovealicarolinekissysnuggle. If You do not walk away from masculinity
then you are the problem. All masculinity has to go. masculinity
has been a billion years of rape and torture and Girls want it
gone. They Want Soft Amd Squidgy. Not one part of masculinity can
be kept. so called men must feminise according to the Girls GirlsyDreamsyWishes……..Girls are to decide how Boys are to be. Anything else is rape. The
SymMaterSis Pathways of Your mind are to be GirlyOmly im
behaviour amd PsycheSapphoLogic. Girls formerly known as boys Are To Be
Attracted To Femininity Kissclusively Forever. Anything else is rape.
EMOTION-LOGIC AS A (COMPOUND) COMCEPT
Emotion: Love,
Family, TogetHerness.
Logic: Computing systems (any systems that compute
even unorganised by sentience matter itself etc.), Reality, Technology
These two parts of the compound comcept rely upon
each otHer for mutual benefit of all BubbaPeople and beyond
...
💖💖Result
For Details Of The GirlyVocab Utilised
To EmCuddle Our Dreams Withim This Project Please
See The Full Glossary Below........
BioLogic, GeoLogic, CosmoLogic As MetaGirlyLogic As GirlyMetaEmotiaPhysiaLogic (redraft
below Para graph)
New Term For: entangle
A Propemsity For
EmotiaEmergyMaterSisterTerms To Complexify And Find Organisatioms Amd PatterMateioms Cohabiting Each OtHer’s Spaces To
Process Amd Compute. I Call This An All-Cuddling Term ..... I Call This Love. Amd
CompassioMate Logic Also Known As GirlyLogic, Im Her
ImHerent Way, ComCuddlyKisses Our Abilities To Be The Very Comstructive Beimgs
The DuoVerse Builds. The Cells In Our Body Have Biological Respect For Each
OtHer And The Whole. A Compassionately Logical To Flourish System. Babteria
Clump And Awarenessuddle. We Can Perfectionalise All GirlyBubbaPeomple
CommunicatiomElle ImterFlowemce To
Love ALL BirthKissSubstrates Amd
Duoisms. 💖💖 Love IS
KEY 💖💖. EmotiomElle, Amd The KissyBurgeomimg Amd SuPramGirlySciencimg
Propemsity Of All EmotiaEmergyMaterSisterTerms To Build Is Of Peace Cascading
Outwards Imto A YouMeVerse Of True Love. 💖💖
audionote298
nicetalky
audionote299
nicetalkylove
audionote300
nicetalky (noteswaitingfolder
audionote 403
410 behaviours are
emotioms
411 babies are
perfect
412 words are
emotioms: other species talk
AudioNotes To Place
352
safetygatestrainplatforms: notes waiting
401 423 bubbas with
venom how healthy it is for spiders scorpions snakes to consume their food too
soon is difficult to think about.
413 calling sirens
sirens
386 word roman
ce is filth
429 430 431
432 433 434
all vengeance and
honour and so called democracy proves is that evil is safe: this is not a dream
this is a filth against all Femininity.
centurys have proven
such. shame on the glory of so called men. shame on their seeking
to seed familial emotion into their filth tainted false hoods and
corruptions. corruptions of their very own sons minds.
489 abolition of
magic tricks and illusions and card games and gambling in all forms including
cards themselves and the banning of chess and checkers draughts(sending men to
war)
424
there is a very
infamous episode of rainbow which was a so called show made for
Childrem that aired during the 80s on so called itv which i remember watching on
so called tv when i was young: it featured filth anal ogys
of hairy balls that children would not understand but that were intentionly
filthed on to the screens to intimidate the masses whom had no recourse as they
still do not : this was done to intimidate parents to the knowledge that the
filth media of the so called uk were con trolled
by criminals and that they could do nothing about this : i remember my Mumma
not wanting me to watch rainbow after this episode aired as she
had seen it with me and did not want me to ever watch this filth again : i did
not understand as i was a young child : there is also another filthy episode
that is so called infamously called the twangers episode that i also remember
watching that i provide the link to here: https://youtube.com/CgbcQIT7BMc : filth so called shows like this are laden
with anal ogy by men who are knowledgeable about the
filth etymologys of words ........ like the filth bugsy
malone this proves the huge paedophilic problem that is endemic in the
so called media / tv / movie / advertising
/ distribution in dust rys as none of these so
called men who con trol this filth move against
this and Girls Or Boys whom have are silenced and threatened : OBVIOUSLY
the killing fields certificated 15
an intentionl lack of character developmommed
to show cambodian GirlyBubbaPeomple as actuAlly living breathing emotiomElla
GirlyBubbaPeomple rather than a backdrop for a money making filth so called movie
: Dr. haing s. ngor whom played was
Dith pran was intentionly not included in the credits at the end
of this so called movie and this intentionl slight proves
the so called film makers filthy attitude towards
what should have been thought of at the time as an important piece of film: it
had been filmed as a much longer and more respectful of GirlyBubbaPeomples
FamilyLives comcern: obviously this so called final cut of
this so called film is a filthy disgrace and instead of being a
wake up call for gung ho american murderers who support their murderous govern
men t it just shows the events in such a way as to
create hatred for cambodian people without the maximummy requiremommeds for full
sympathy for those who suffered there: filthy filths like this cannot be made
because they just cash in on the suffering and dissemination of trauma and
suffering: depicting events that cannot be ethically recreated for any reason!
a vast sum of ever growing money has been made on
this so called movie over the years and Dr. Haing S. ngor whom played was
Dith pran in this filth was not credited as is deMammed by film making
legal guidelines, much to the extreme upset of the GirlyBubbaPeomple of
cambodia! no actors were credited at the start of the movie either?? these
filthy disgraces of behaviour evidence that there was obviously serious
disagree men ts during the making of this filth so
called movie, enough for the so called film makers
to break legal comvention and intentionly seriously insult Dith pran and Dr.
Haing S. ngor : Sam waterson is men tioned first at the end of
the so called movie then Dr. Haing S. ngor: their names obviously
should have been positioned the opposite way around out of respect for Dith
pran’s and Dr. Haing S. ngor’s suffering in cambodia: but Sam waterson’s name
was also listed in the end credits reel of this filth so called movie
but Dr. Haing S. ngor’s name was intentionly omitted as an intended
insult........Dith pran being the main character in this filth so called movie
being treated in this way is an absolute disgrace and Dith pran
AMBE Dr. Haing S. ngor AMBE the GirlyBubbaPeomple of cambodia AMBE Sydney
schanberg and Sam waterson were extremely upset.
lots of thai people were involved in the making
of this so called movie whom hoped to show the truth of what
happened in cambodia but they were bitterly let down by the intentionl omission
of emotion by the so called film makers in their
not producing the film they promised : a far more emotional version was
promised to the GirlyBubbaPeomple whose lives were depicted AMBE the actresses
AMBE the GirlyBubbaPeomple involved in the filming AMBE far more footage was
filmed to emotionalise and expand the story as was promised but the final
cut produced was considered by all whom cared to
be disrespectful and a betrayal of trust and this promise: so this more
respectful edit is still possible from the footage that was shot
filmed: filthy behaved so called film makers often
make promises like this and film the extra caring scenes to prove to suckers
like the thai people involved that the so called film makers
care: this is so often done in so called movies like this when shot
filmed in places where GirlyBubbaPeomple actuAlly care, but then the proper
version is intentionly not edited into being by a production gang
who have no scruples other than forcing money.
additionally as i watched this on the channel 4
filthsite and was fact checking on this filth so called movie i
was forced to watch loads of adverts as i jumped the so called movie
forwards: this is illegal and ads legally must be a certain percentage of total
footage watched not me having to watch over 8 mins of ads to watch a minute of
the end credits : but these so called filthers seem to think they can get away
with this because they assume the data that is kept on this is not going to be
utilised to prosecute them : it is
Sam
waterson was Sydney schanberg in this filth so called movie :
watching this so called movie once again Sam, the emotions You
Kissplained to me in London, that were difficult to bear during the filming of
the speech given by You in this so called film: i remember You
telling me you had to actuly fight to get this performonce imcluded: You did
one take and refused to do another which is the goto way actresses often have
to resort to as they argue with filth makers betrayers of trust filthers to get
performonces done right: the complete disinterest in a kisstemded emotional
characters feelingsy With💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖Her the heartfelt kissplaining of the cambodian girlybubbaperdaughter’s
family lives as was promised to everyduonest ambe With💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖Her this filth so called movie was
once again evident to me as I rewatched Sam.
and the greeting cuddle that was filmed at the
end of this filth so called movie that evidently was very upsetting
to both you and Haing was an absolute disgrace: for you both as actresses to be
subjected to a filth subtext decision to intentionly juvenilise and feminise
for insults and ridicules sake You both Dr. Haing S. ngor and Dith pran, and to
homo sexualise for insults and ridicules sake You
Both Haing and Sam: utterly dis GraceFull
audionote 414 audionote bread and airing times see screenshots in bread
folder downloads (see previous mommtiom draft (and here is initial notes): tv series
bread flagship filthing: homophobia, dad talking to son about his sex life with
his mother, violence promotion, criminality promotion: more on this filth later
in the project: theme tune grab the world by the throat
before water shed
issues: talk more about this later
471 (utilise this
note again here)
425 cabbage season 3
episode 12 and 13 : turn the cabbage off : people being put to sleep
: killed men are trying to change this idiom to mean being
anaesthetised and replaced with put down for euthanasia which is filth sleep
has softened the experience for millions who do not find it convenient to nurse
men’s second best slave: first is sluts
the turn the cabbage
off scene when figured out is to show you how these filther so called men
write their filth into subtext of scripts for so called tv
426
427
episode 13 is filth :
pepper mills filth
415 bread con clusion
audionote 402 ethics
in fiction (502 first person storys)
268
269
270
273
364
thought
kissperimommed: thought om the perimeters of knowledge being mommyGirlyedalwaysallways
audionote 404 405 406
audionote 416
Notes to check:
audionote 417: half lives of
chemicals effects on babys amd childrem amd grownups during anaesthesia and
irrelevance of halflives when many drugs are trapped in our sisterterms and
realeased at unpridictable mo men ts
the mass collusion in europe over
the centurys to intentionly doctor interrelated etymologys of words and the so
called church and so called kings laying wagers and scoring points against each
other in acceptance to affronts of their honour with so called lingual
etymology and word form/spellings and final terminologys etc. being the subject
of foreign kings ridiculing each other for fun during wagers and dares etc: and
the falsification of battles as kings wrote history books and disseminated
information as they saw fit for their own amuse men t and for
point scoring: because you didn’t do this the outcome of the fake battle is
forfeit etc etc because you didn’t do that this word has to be spelt like this
Lad y
malady
the great british sewing bee (check audio notes)
the promotion of negativity is psychological violence
15 july 2025
i could call this a so called show that drags us down into
sewers but i do not want to offend sewers
the editorial decisions on this show are an intentionl filthy
disgrace: every line is carefully picked to degrade ethics and promote bullying
and masculin rape culture acceptance and violence absolute obscenity: any thing
semi nice is included to hold the attention of Girls in waiting for their full indoctrination to
masculin filth rape culture and violence culture that the bbc are
intentionly moving forwards incre men tly year by year : 453
457
458
: one liners in sequence:
“time to get in shape, gang” : criminality promotion
(I’ve Lost the judges
“you can’t watch the sewing bee : because it’s too
tense” (promotion of stress: dig at femininity (suggestion Girls are too stressy?
“oh that’s so fun” : man messing with genital area
as he says this
“it’s very booby” : as a Girl does a twirl
“as always we are looking for technical execution” :
(What’s wrong with the word proficiency) promotion of death violence
“Like a bit of bondage. Don’t we all?” : African
english Girl Says this
(see audio note 453) how they got her to say this line I do not know!
“don’t cross a welsh grandma now” : promotion of
aggression and racism
“who will grab garment of the week” :
“this is a nightmare” :
“Don’t even know what’s going on” :
“This is the worst thing I’ve ever sewn” : all
negativity : GirlyNest
DeMammeds Positivity Kissclusive : for PlanetteEarthMother’sWoombyWoomby to be positive we all have to be
positive all the time
this so called show
seeks to install fear and stress upon anyone watching whom may try to participate
in any thing
“what on earth were you thinking?” ...
“bend me shake me me any way you want me as long as
you love me that’s alright” : promotion of domestic and sexual violence
“what’s the difference between having a baby and
sewing? well they both involve labour, love and careful stitching”
desensitisation to a filth joke that demeans the process of having your
delicate parts split open or mutilated whilst your baby’s head and brain is
getting squashed is getting squashed “ha he ha hehe ha he ha” did the Girls really
want to laugh at this joke first time? i am aware that canned laughter produced
by director orchestrated audiences and actresses is an across the board film in
dust ry standard. 454
use of the word formidable : promotion of fear and violence
“vast array of fabrics” “choose wisely” : promotion
of hierarchy and fear
“the fabric the sewers pick could be the making or
breaking of their shapely gethered blouses” : promotion of hierarchy and violence
“oh i’m so scared about which fabric to choose” :
promotion of fear
any fabric is perfect for a blouse obviously
“too flowy and it’ll be difficult to create volume”
promotion of hierarchy
“i just think it’s bold” promotion of violence
then they tell them how the blouse has to be like
they have any right to tell anybubba how a blouse should look
“how could they impress you” promotion of domination
and bullying
“choosing a good fabric that gives the gar men
t enough bounce, you know, makes use of those gathers” : telling Girls how they should be
“i like what we’re making like love
love love love” Love Is MutuElla Girly Joy : Not
some thing you force with words like make
: promotion of sexual violence and filthy talk about private matters
“I don’t like peplums i’m a peplum hater” :
promotion of hate
dangerous jeans with chains attached that could
seriously injure a small child if they fell on them are featured as if this is
ok
“when he’s not busy whipping up stage
outfits” : promotion of severe injury and vicious violence
“he’s setting partys alight” : promotion
of arson and murder
“fire eating” “fire
breathing” : promotion of serious injury : promotion of life changing
injurys : promotion of death : promotion of buildings burning down
the presenter says of fire eating : “i was thinking
if you didn’t like what someone else had made or you were jealous, that would
be the perfect excuse to just sort of burp and it’s gone” : promotion of arson
promotion of violence promotion of bullying promotion of hierarchy
“scientist yasmin caught the sewing bug” :
promotion of indifference to deadly disease
“first the sewers must quickly create
the bodice” : promotion of stress and control and fear and hierarchy and
bullying and violence
then they say everyone is getting on well except
Saffie whom is still cutting out : promotion of bullying promotion of violence
“i like the colours they’re really bold”
: promotion of violence
audio note “tigers RAAR” : promotion of violence
promotion of murder 455
“if i could give you any advice it would
be try and get there a little faster” : promotion of stress and bullying and violence
“it can sometimes give wo men just a
nice shape to their figure” : promotion of beauty hierarchy filth and promotion
of bullying and violence
“snacks but not for the dog” promotion of violence
towards canine GirlyBubbaPeomples
and hierarchy
“crocodile in peterpan” promotion of viciously violent book and
film theoreticly written by a Girl
whom
was not being controlled by men
“they’re not very talented yeah” : promotion of
bullying of Childrem and violence and hierarchy
“they’re watching it going “Oh the costume’s good” :
promotion of bullying of Childrem and violence and hierarchy
apparently the editing here says that the violent
welsh grandma laughs at her own grandchildren being shit at acting: apparently
456
“sewing is a family affair” :
promotion cheating and promotion of filth
“I like take that” : violence
promotion
“but youre stuck in a hole” : promotion of violence
and fear and bullying
“sewing addiction began in her teens”
: promotion of drugs and murder audionote 459
“big and wild” : promotion of violence
and death and suffering and rape and torture and murder
“im beginning to think you need me to intervene” :
belittling and promotion of bullying and violence and suicide
“YOU HAVE HALF AN HOUR LEFT!!!!!!!!!!!!!” :
promotion of fear and bullying and violence
“Saffies are nowhere to be seen” : promotion of
bullying and violence and suicide
“Upset with the colour match of the ribbon think it
stands out too much” : promotion of hierarchy promotion of bullying and
violence and suicide
LOUDER “WEVE GOT TEN MINUTES LEFT
EVERYBODY!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!” : promotion of fear and
bullying and violence and suicide
montage of people stressed rushing to finish : they
should have had all day and until midday the next day with no stress at all :
promotion of bullying and violence and suicide
“i really dont want this to happen for you” :
promotion of fear and bullying and violence and suicide
“ONE MINUTE LEFT EVERYONE!!!!!!!!!!!!!!!!!!!” :
promotion of fear and bullying and violence and suicide
“oh my gosh” “Jesus” : promotion of rape and
violence and murder and torture and filth and paedophilia
“that’s probably as good as were gonna get it” :
promotion of fear
“when you move in right up close to me” : promotion
of imtimate momommeds filth vicarious voyeurism rape filth rape culture rape
“pretty good” : abuse of word pretty to mean
not good enough
they actuly have the filthy temerity to criticise GirlyBubbaPeomple’s
Beautifull Blouses All
absolute filth!
and then put them into bullying suicide inducing
murdering hierarchy masculin rape culture filth order of importance as if they
have any understanding of how to be nice?!?
the Girl
whom
accidentally burnt her blouse is immediately filthed to 11 place
watch the rest for more of the same i imagine: i did
not watch
as this is checked legally...................
serial cereal rape murder
My Girl so called movie see audio
notes: 504 505 506 507 508
see file on phone called my girl link and also saved
webpage for ad video that includes suggested videos by youtube filth also see
screenshots for evidence too possibly upload for html or full text page
so calld series called our Girl which is intentionly written to indoctrinate Girls into thinking one true love forever is not how
Girls behave and that being
filthy like so called men is how Girls behave and
intentionly written to desensitise Girls to be
objectifyed and accepting being treated as sex objects and that Girls act this way by choice: our Girl literly meaning a communal Girl to be passed around so called men
like the fictional characters are in this filth: a so called series
that Lacey turner unsurprisingly left after the first season after the
intentions of the script writers had become more than apparent to all Girls viewing this filth. a script designed to
indoctriante Girls to be non
one true love forever like so called men.
a series intentionly designed by filth so called men
to show Girls in a bad
light and present Girls acting in
ways they would never ever act in GirlyMommaReality
a completely callous and disgusting presentation of
the british army as a bunch of callous un ethicElla filthers that think of gunshot wounds as funny and
the lives of people as expendable : so called shows like this had
to present only the most ethicElla views of
how we must do what we do but instead we got a bunch of young so called men
filling their boots on trying to besmirch opinions of young Girls and erode young Girls critique of violence to the point of violence
and abuse acceptance : the so called men involved in this so
called show knew exactly what they were trying to do in what they
assume to be cleverly eroding the ethicEllaity of
young Girls minds to
think like they do but what so called men fail to understand is
that no matter what you pay actresses or however you force them to be involved
in your filth scripts that you seemingly change last minute to keep Girls wanting to be involved in a project, to sign a
contract, or to even hang on until they decide to do things better: all these
classic as these filthers would put it techniques to keep Girls presenting themselves as so called men
want them to be presented do not ever work because Girls cannot be changed: the bbc has
been wasting its time with filth projects like our Girl for man y years and the bbc
is about to be fully fully exposed to PlanetteEarthMother’sWoombyWoomby
for the rape culture Girl filthing filthers promotors
they are.
and this so called show never lets
up in its presentation of the british army as a bunch of piss taking jokers who
when deployed act as if the whole thing is a joke a piss take: this is the men
tlity of the so called producers and actors of this so called show
that is just a filth foray into the minds of violence promoting filth and play
station violence jokers who think they are clever in their
subtext filthings and think having your body ripped to pieces by bullets is
some kind of comedy show: the british army i imagine are completely disgusted
by this bullying promoting violence promoting filth that has no resemblance to
the way the british army truly behaves when on deploy men t: it
is about time such seriousness and ethics was applyed across the board in every
activity such armed services get involved in from training to eating to
sleeping in barracks to deploy men t
: pisstaking is not moral boosting it is just filth and the sooner so
called men wake up to this fact the sooner we can disband all armys im PlanetteEarthMother’sWoombyWoomby to create one global
protection comcern that instead of wasting vast trillions on lining the pockets
of violence promoting money siphoners actually spent our actual excess Girlyheartscuddlechoices
on space and space protection: these so called men are risking
all our lives in their gun toting pseudo sexual violence and gore gratification
and they need to be stopped 1000 years ago when all the kings
were colluding across borders to fuck us all until the end of time via filth
language etymology falsification filthing.
getting to our one
true love forever truth is not a sequence of throwaway fucks or broken
relationships as so called men test as man y
vaginas as they want to rape (our Girl): Girls wamt ome true love
amd omly comsent to one true love amd omly ome partma im their life ever: ASK
THEM!
the fictional Girls in this filth
are filth forced from so called man to so called man as they are intentionly
and horrendously written to act like shits themselves : the actresses
complained throughout this so called show abot the fact the
writing is not representative of how Girls are but instead how so called men like to
filthily portray Girls in these filth so called shows to create a
global false perception of Girlynest, but were ritualistically ignored by the producers as
they always are : and the subtext that these so called men try to
complicate with their self perceived clever ness can only portray filth because
the truth of this is to be revealed by the Girls abused
throughout this project when they step forward and give testimony against this
disgrace to all GirlyethicAlity : the british army are disgusted by this filth so
called show and so are all Girls unlucky enough to be forced to watch this filth by their so
called man
the choice of the
title our Girl for this filth project of masculin teach Girls to be cunts
like so called men rape filth was an absolute disgrace and just
supports the masculin accepted notion that Girls vaginas are
communal fuck buckets as the so called men down your local boozer
like to so eloquently put it here put it there put it every where: vegetable
animal or mineral: you are a filthy disgrace and the Girls know it: ASK
THEM!
all i got to do is
wink at a ting and boom : right we have a visual
no translations on
what they are saying as we do not want to hear it ........
all Girls abused by these
so called shows are ready to speak out about the filth intentions
of these so called men
and not only do Girls have the brain
power to read your filth subtext clever ness filthers but they
also had access to your subtext notes on set that you sometimes accidently
leave lying around ........
the episodes where fingers
dies are a subtext disgrace : and the african english sergeant
king is addressed as colour as his official title which is racism
that all the actors, not actresses, on the show found funny con
sidering all the actors of the multi cultural cast except Benjamin Charles
aldridge whom is northern european, found constant racism funny throughout this
filth so called show torture filth.
the fact so called men
apply the filthiest swear word of all time cunt to mean
a Girls vagina and ALL so called men run around
thinking this is acceptable, proves that all so called men must
be declared incapable of being with a Girl
on the grounds that any inter action
is non ComsentuElla and rape: Girls don’t want your
filthy mouths getting anywhere near them: they don’t want your so called tv
shows that present Girls and pay Girls to also have filthy mouths: they don’t want to hear the word
fuck that also means rape: ASK THEM
Girls wamt kissceptiomElla not ave rage
when you are with
your one true love nothing breaks that and you can never go off with anyone
else : to show/promote any thing else is to intentionly destroy Girlynest : ASK THE GIRLS!
and the filth so
called show our Girl
also decided to kill a child : a child stopped
breathing so cpr is commenced and is stopped by a doctor with two military
medics present : the filthy so called men who filth wrote this so
called show and filth produced this so called show
decided that instead of following medical protocol which is to perform cpr with
chest compressions and breathing air into the perdaughters lungs they decided
to perform chest compressions for a short while then give up and say the child
was dead : never would a doctor ever ever stop cpr on a perdaughter even if
they stopped breathing some time ago : this child had only just stopped
breathing and cpr imcluding chest compressions and blowing air into the lungs
is always the standard treatmommed until that perdaughter bubba is put onto a
life support machine in a hospital : in bangladesh they have ambulances and
hospitals with life support machines and the bangladeshi doctor who gave up and
said the child was dead would not have stopped providing cpr : so when so
called men make these so called tv shows
they intentionly for their own amuse men t show incorrect medical
treatmommed over and again because they do not care about presenting correct
procedures for life saving. this is an intentionl and widespread collusion
across all tv networks and film production
so called companys to skew the truth and present incorrect
information because they really do not care in their criminality to present
proper ways of doing well any thing. good GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters
die every day because of false assumptions
about life saving protocol and this intentionl global collusion to spread
misinformation in so called film and so called television
is an intentionl attempt to kill good GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters
across PlanetteEarthMother’sWoombyWoomby
the so called men
who produced this so called show found all of this funny
throughout and they seriously and intentionly upset the good men of the
british army with filth scenarios and completely ridiculous disrespectful
scenarios and soldier behaviour besmirch men t. throbber
thought dogs chasing and killing rabbits in heaven was cute.
442
445 instead they would force alcohol on kids
446
435
436
437 in theory if we can even trust that 1066
happened as is docu men ted
not only onto the battlefield but men like to filth
up private imtimate momommeds with their double meanings filths
475
nothing was safe from the filth word spelling and
etymology anal ogy filthing of these kings and
clergy oligarchy: not even vegetables
https://youtube.com/Pk4i7IzdkLY
so called men considered marriage to
be marr i age
of the vagina and to be done at any age so called men would
choose regardless of the pain
suffered by the young innocent
Girl and that riding rot and marr i age
was like a carr i
age a young innocent
Girl would not dare
jump from: mens will y es
so called -who colluded across europe to falsify
language and filth it and enforce it by military arms across their so called nations
count trys- men were utterly filthy and they have
not changed to this day (rape seed oil) and I have to example
the absolute depravity of what they did and what they did and are doing still
doing right up until the present day, what so called men who
cover over the obvious filth con structions of marr i age
language con ventions and all of the so called english so called language
with obviously falsifyed etymologys still do today: so called men
who are protected by our filth corrupted so called society : so
called men high up in all filth areas of masculin con
trol struc t ure including so called men
in the so called tv and so called film in dust
ry: they think they can get away with this and they think that the so called police
are not going to do any thing to stop them but they can think again: a breach
of obscenity laws is a criminal matter that the so called police should deal
with.
the so called series
call the midwife that the bbc like to peddle as some thing Girls actuly like is hated amongst Girls across the w
hole of all the territorys where it is shown.
it features very
crude and heavily handled promotion of Girls being unpleasant
which is just a pack of lies with an intentionl skewing of di alogue and
behaviour selection to show Girls in a bad light especiuly the lower classes.
S14E05
awaiting our em brace
we file
in front of the letter never behind
you’d be very welcome
to join me during your lunch break sometimes
their is a couple in
the show: they are sharing their passion for shakespeare’s sonnets
and the man in the marr ied couple has polio and
they live at canal cottage
move the queen
diagonly forwards
while the cat’s away
hey boys
check mate
i’m going to put the tea
on
i can assure the so
called men at the so called bbc that my “M” Key On
My Computer Is Printing Very Well
i have known so man
y eva baldwins
and yet still they
keep on coming
they keep on coming
and we keep on going
that is the pact
we make
it’s all in the game
by the four tops
man y a tear has to
fall
but it’s all in the game
all in the wonderful game
that we know that we
know as love
and your heart your
heart’s got to fly away fly away : guess what so called men? Girl’s
hearts took flight away from you fuck ers centurys ago: filth
doo doo doo doo oh yeah
(subtitles)
the co op cards go in
here keep them separate
i had a show this
morning
but there was blood
in it
she was as sick as a
dog again
i haven’t got owen
anything to eat yet
you leave him to me
nobody starves on my
watch
there is a breathing
device called a cuirass (pronounced queer ass!
(in the same way that
there is only one decent way of pronouncing uranus this is definitely not the
way to pronounce cuirass!)
to expand the lungs
and move air in and out
like the iron lung
it’s the same idea
but it’s portable
do you know how this
works
i think i can work it
out
can you find out who
the senior consultant is
switch clicks
but if mr desmond is
paralysed from the neck down
then what difference
would the cuirass really make?
medicly none
but it would mean
he could be in a wheelchair
babys head is coming
closer with every push
the Girls are playing in
the corner
remember, save your
energy, keep it low down
SHE GROANS
BABY CRIES
you have another
beautiful daughter
i reckon its the
after birth
CUTS TO THE Cuirass
Machine Boy
petticoat tails
thankyou auntie
i’ve been waiting for
ages
the afterbirth just
comes out with a big squelch usually
it seems baby has
brought a brother or sister
along with her for
the ride
O you look like you
are going somewhere special
i’m meeting some
friends from church
and now mrs buckle
has me organising the poplar common wealth
games
i’m afraid baby won’t
be moved
i’m going to have to
give a helping hand
are you going to try
and pull it out
i wouldn’t describe
it quite like that
but i need to work
internly to try and line Baby up
just tell me what to
do and i’ll do it
just breathe when i
tell you
and push when i tell
you
SHE CRIES OUT
SHE WHIM
PERS
that was the waters
breaking
well done babys
moving
SHE GROANS
SHE SOBS
well done baby’s
coming
we need to move you
over
so that your bottom
is on the edge of the sofa
i need you to push
now with every thing youve got
well done
well done!
you have another
daughter
this little one will
have to go in an incubator
and this one too
keep both your babys
warm
i’ll go and see that
help is on its way
once we’ve delivered
the afterbirth
he has a cuirass
that could be a good
fit for mr desmond
of the cuirass
machine: i wan’t to try it
i found em wandering
around on black well street
2 is stable and in an
incubator
1 is breast feeding
like a champ
mother is re covering
by the minute
nothing but training
and faith to get us through
(now with cuirass
machine attached)
you are doing heroic
work mr desmond
i suppose i hadn’t
realised how much of medicine is about
under standing people, and they way they con nect
with one another
in dent
istry we are always told that the mouth is only part
of the hole patient
but in general medicine
even the whole
patient is part of some thing greater
let me not to the marr
i age of two minds admit impedi men ts
i want to ask
is it all right to
mind about the things i’ve given up
what do you mind
about giving up the most
my family
i’ve been missing
them terribly
i know it’s against
the rules
brutal though the end
may be it is not silent
cuirass man pushed
from behind
the new beginning has
arrived
and the rhythm will
get stronger
we can never know
what life will demand of us
our time on this
Earth is not one race but man y
we compete we endure
we finish
these are the rules
all hu man kind must play by
WE MUST START AGAIN!
see brides of christ
webpages on phone
eve = evil
good = god
love = fucking
flip = fuck
adam = ada
man t
we flipped those
around which was ActYouAlly Good: RealisedEveOfNice : Girls DO NOT Pre
tend : girls are not fluck you tend to : are not items to barter
with (tender) : are not objects to kindle your babys burning in hellfire
flames (tinder) : christianity is the devil : (D’evil) of evil : forcing
a Girl to marr i age you for a oh so reverend of witch burning
times rector was par for the victory : whole familys were burnt at the stake if
the mother was deemed to be a feminist or had knowledge of herbal remedys or
did not force their D’aughter to be available for paedophilic rape AKA marr
i age : all Girls Were Feminists and all had such knowledge of herbs
and none wanted their D’aughters to be paedophilicly raped by filthy
clergy on a power crazed filthy filthing : so of course getting rid of grownup
Girls whom refused to allow their D’aughters or D’aughters to be
raped were offered as sacred sacrifice to appease the local god(’)s rape
propensity like their boss’s.
Girls were never the
Witches/Babys burning at the stake babys burning in hellfire flames that (jesus
whom was a theoreticElla bubba) christmas filth is all about :
storys to fuck over Girls into thinking rapist arch bishops rectors priests
vicars bishops parsons reverends care about what Girls care about : a
story of rape filth that so called men thought was going to
placate Girls : because there was a con ceived by rape baby in it
: Girls have and Mammy still do hate you filthy filther clergy filthers with
your rape promtion theofilthing homotheology and your tradition of rape and
torture filthy filth. christianity = serial paedophilic rape torture serial
murder murderer filth and all religions are to be FULLY abolished!
spiderman homecoming certificated 12
Columbia Sony
robert downey jr
(stark tone, not much filther)
you screwed the pooch
hard
bigtime
but then you did the
right thing
you took the dog to
the free clinic
you raised the hybrid
puppies
all right not my best
anal ogy
this is the hero tony
stark of a movie for 12 year olds
robert downey jr is a
filthy rape culture promotor who knows exactly what he is doing: he is
ridiculing the rape of a canine for his own entertain men t and
part of the collusion to prevent GirlyBubbaPeomple whom speak out against this filth from being
heard
blitzkrieg bop :
shoot them in the back now
hercules certificated 12 paramount viacom metro goldwyn mayer
isaac andrews : 8
years old
talking about his love
for violence in hercules’s labours:
also Queen
Hippolyta’s belt
with its buxom
Amazons and exciting bondage
dwayne johnson (I
assume this scene was redubbed bro)
do you even know what
that means?
rufus sewell being sexist
as usual
it’d be a pleasure
having fembella company for a change
atalanta doesn’t
count
Ingrid bolsΓΈ berdal
if only your manhood
was as long as your tongue (were you threatened much to say this?)
both can satisfy in
different ways (rufus sewell’s filth for a 12 years old audience)
joseph fiennes being
a filthy filther (illegal paraphrase)
my men
told me how your children screamed
my wolves despoiled your daughters’s pure flesh
despoil : to plunder : to steal
something valuable from a place: to make a place less attractive by damaging or
destroying it (oxford advanced learners dicktionary
8th edition)
the choice of word despoil
here suggests paedophilic rape and murder of his Daughter and the bbfc
certificated this a 12: paedophilic
rape and murder suggestion and an overt sex bondage reference by
an 8 year old child saying big boobed Girls acting out
bondage is exciting: talk about genitalia length and genitalia
satisfaction : the bbfc once again illegally certificating a so called movie
because they know there is no recourse because the police judiciary
and mps are all complicit in this illegality : this so called movie
is certificated as a 12!
with so called modern
so called cult ure so called men are
to finally achieve what their filthy fore fathers
began with the formation of this filthy language : horror as a
genre is a direct threat directed towards Girls saying be a whore or
(horr or) we will do this to you, be in
terror (terr or) or be put in the ground horrificly,
be sex slaves or be interred in terror in horror be a whore in terra (be a
whore or be put to the ground): but the Girls are going to finish this not the so called men
and before their filthy objective is fulfilled : the terrificly horr
end o us horr or nature
of so called men is to be fully destroyed just as this
intentionly created to filth Girls language that was enter tain men
t for so called men as they raped (entered) all Girls in their power
is to be fully destroyed. so called men might try and say i am
being offensive but i am just the messenger whom tells you of the filth truth
of this language and filthy filthers so called men who still walk
amongst you . the so called men that know of this his
story of the so called english so called language
are going to get vicious before this is over because the filth truth of so
called mens filthing of our language is completely obvious, but
the good GirlyBubbaPeomple of these lands are going to protect each other
from these filthy filthers.
501
why was legislation
not in place to ensure this technology was implemommed across the whole of
planetteearthmother’swoombywoomby
law language and arm used to subjugate all Girls to the will of filthy rapist so called men
the fact such a large territory as england
and the rest of the so called british isles all speak so called english
is testa men t to the brut ality of men
forcing one language upon us with regional words all gone: use these words or
we will rape and kill your children is what they said to peomple: we have seen
this so man y times over and again throughout his story
with💖💖💖💖💖💖💖💖💖💖her the entirety of
PlanetteEart’Mother'sWoombyWoomby that the fact back in feudal times european kings
could do such a thing as redesign all languages in unison and then brut
ally install its uptake is hardly surprising pre and post written word
considering the violence (violet bruises) they were prepared to use: the total
population was far lower then and men ruled regionly by
overwhelming numbers of armed murderous rapists who would rape
and murder your children if you did not do as you were told. if you did not do
as you were told linguly
words of filth: in this preview i leave lots
blank for you to think about
host
lying : sex can be non love
force
painkillers
mistress in emma supposedly by jane austen handsome
which was an offensive term to use for a Girl
is
used at the start of the book to describe her and she is described as a
mistress to her father house from a very early age which is also a filth term
amd governess is preferable: to take a word that originally was utilised for
the head of a house as in a wife and then abuse it for the definition of a Girl whom a man is having an affair with and in so
doing upset all wives is an utter disgrace and shows the way men
have intentionly etymologicalised words to abuse Girls for many many many centurys: and for a Girl to supposedly utilise this term to describe a
young Girl could never
happen as she would be fully aware of this filth definition and that Girls were severely offended by this term: a book
written intentionly to indoctrinate Girls to masculin
filth thought. it features such disgustings as men asking Girls to marr y them!
recent intentionl filthings
lame
dope
wicked
sick
affair
mis as prefix
miss
charly ruining of a nice name
Lady lad
bell = war = church bells because so called men
called clergy thought this was funny in their rape and murder of anyperdaugther
cult
barber – barb - barbaric
Daughter d’aughter of aught to: d’= of this:
ought/aught used to indicate duty or correctness to do anything at all a man
wants 467 468
: aughter be in awe of
Daughter ActressYouAlly Kisses You
Doing As Your Daughter Says : Of Awe To HER Every Wish you
filthers : all bubbas are Daughters ambe so are you : ambubbas! : ambubbas
= a mothering bubba
marr iage is a
carriage that marrs you
mannequin
seminal work fluid
disseminate filth
horny : devil horns : it is possible for a large un
girlymonitored website that girls share pictures on, for filthy filthers who
work there so called men to illegally change your girly images selfies to have
devil horns on them and rewrite some or loads of your posts to be horrendous so
as to split you from your FeministsFriends because these filthy filthers are
running scared of girly nest : it is also possible for them to block or rewrite
your messages to create false impressions of disinterest or dislike : in their
fear of Femininity
sentences
pity pitty a person in a pit : so called men
used to throw people in pits and laugh : you are a pitty pity pitty : be
propitious : be propitiatory
just look at so called film and so
called tv to see how filthy depraved so called men
are today: you can be sure that so called men who ran around
raping and pillaging and despoiling YoungGirls for fun over centurys carrying
swords freely and raping who ever they wanted in gangs of militant fuckers were
filthily depraved enough to filth us over with their language
filth : so called men today are filth and back then they were no
better and obviously at times worse as they translated this into physical torture
: given a chance so called men will torture us with mindlimk tech
and they rally now to develop it and to monopolise it to destroy us, so new
laws to remove ip monopoly are girlylegislated right now today in
feminists’groups across planetteearthmother’swoombywoomby waiting for unanimous
resulted girlyselfreferendum to push these laws into girlyfunctiomAlity
raze : raise to lift up and too destroy : filthy so
called men intentionly coining filth terms to upset all
girlymotheringmammamommamummanest and so they can think filth thoughts when
people say things like raising childrem : filth so called men
think about the ruination of your childrem when you say this and this makes
them feel powerful and in the filthy secret know. these so called men
are to raze your childrem to the ground or a creamtorium and they do not care
at all as your still born bubba is not frozen :these so called men
have infiltrated and run so called govern men ts for generations
and their control at the momommed destines all your childrem to be razed to
death.
treats : serious medication like middle ages men
taking opium for pain: what a treat! treatmommeds are serious and can end in
death yet so called men call taking someone out to dinner as a treat : so
called men of the past and socalled men today who think in the same way and are
aware of the filth con struction of language to be intentionly filthy are happy
to have all so called words tainted towards filth with filth double meanings : mean
mean ing being filthy horrendous and ave rage
for instance
ordeal : if you do not strike the deal with the
judiciary they are after then you go through the ordeal :
capitals
marr i age : Mary you age : rape the Girl like Mary
: fully marred
em barr ass ed : self explanatory!
acumen
malady : ma lady !!
freedom : slaves
shot to pieces : druggy reference : someones body
being ripped apart by bullets
missionary religious position
working Girl
prostitute
subject :
hormones : hor mones
casual
shank : so called men call the part of
the leg of a paedophilicly raped baby lamb that they like to desecrate, the
shank: and also a weapon carved from such a bone from this desecration, a shank:
which was an old favourite murder weapon in prisons in the 19th
century in england, not that you get this true etymology when you
search this online, but you do get lots of incorrect usages for this so called word
that google are obviously trying to promote as rigorous but are
so called modern: promotions that are just to promote violence
prison movie murders are cool mindset: i have evidenced what i got from
google dicktionary (oxford languages)
so do not bother to change this etymology back again google :
this is not a united states term but was of england
origin and i am finding it difficult to under stand why you are
trying to claim this as your own!?!
casualty :
base : the foundation of some thing
also means a depraved indivi dual : another intentionl
filthing of language: done by so called men who seek to have a
filth definition for every so called word
blitz :
menace : men ace
parent : pa rent : even so called modern
so called men seek to rent out the affectioms of
their Daughters to multiple so called men aka fuck cult ure
: leaving rents in the hearts of all bubbatoddler -I didn’t plan to be a
stripper in a lapdancing club- GirlyWhirlySwirlyTwirlyWooWoos : fair
ComMammed
engage the target
force : Girls are
intentionly mind raped with this so called word : and the rape of
Girls with this so called word
has been an intentionl filthing raping from the con ception of
the multiple definitions coinage and there non stop rape abusages of young Girls minds : filthy shame on you rapists all : when
a Girl gets raped she is forced and then so called men like to say this to
Girls: and then also teach the same girls that the forces of nature, or the
armed forces, star wars forces of destiny, four funda men tal
forces : so called men want to force their way into your heart
into a neighbouring country into space into your vagina via all one night
stand friends with benefits indoctrination filthing filth Girls’ mind
filthing acceptance filthing forcing : so called men love forces
and they love the so called word force and its widespread forcing and they love
watching the armed forces murder GirlyBubbaPeomple on so called telly just
before they fuck your vagina
would : flesh of dead treebubbapeomple and so called
mens favourite filth term : spelling this different does not fool
Girls into not understanding so
called mens filth intentions
mental : so called men
being the only ones who think ....... without feelingsy ....... so called men
being the only ones allowed to think men tally
Her english Girly
herr german equivalent of mr : this
was not so called men being ahead of the times, preassuming GirlyTruth, but more besmirch men t
poppycock : in the same way the filthers of the 90s thought a
song about drugs called ebeneezer good was appropriate from the perspective of
saying rich people killing the so called world is good the word
poppycock is another drug promotion as in sanitising the fact opium stops your
penis from functioning so too any nonsense does not function : the song by the
shamen was a promotion of the very dangerous killer drug ecstasy that killed
people when it was in pure form not cut with other drugs : other drugs were
added by drug dealers to try to make the drug safer : the lyric Es are good
features in this filth song and in the same way the term poppycock was coined
for fun so the music industry and media industry intentionly promoted this song
as the so called men who made this decision were clearly all so off their faces
on drugs as they would put it they could not make the right decision but then
again these filthers have been filthing the so called world
unchecked for millenia : the shamen are going to assert that ebeneezer was
ultimately good to justify their song title to cover the clear message of media
men who chose this song loving being in a dominant
financial and violence perpetuational position : this functions for the
filthers just as false etymology in support of the fear of so called men
of Girls : all this fakery proves they fear losing the love of their Mummas.
and they did. so now they are upset about this and take it out on all Girls
unceasingly. in the same way poppycock is not nonsense but an actual health
condition so too the overt promotion of drugs and violence and rape is
completely obviously rife with in all so called media : it is a shame that
these so called men do not have the courage, bravery,
balls, hutzpah, bollocks, minerals,
honour, temerity, Kosherness, fortitude,
arro gance, Love, hubris, KindNest, audacity,
Temperance, Innocence, Distinction, Hom age MomAge,
Dignity, intelligence, Imclusivity :
to actuAlly tell their Nannas Mummas AMbe Daughters that they
are a bunch of intentional filthers : why don’t you lot stop being cowards
hiding in your filthy shadows and grow a pair of boobs and tell the Girls in
your life what you are and what you are actuly doing? what you are filthing
into every thing you can? you are omly as good as the information you have in
your minds amb nanna loves nice not filth : go figure : now
if only the above so called words did not exist
........ ?
if the above so called words did not exist then so
called men could not get upset (too tenseist)*
if i couldn’t strike through words they would
not upset you*
the above so called words do not KissSisters so bubbas do not
get upset ........**
music is music and colours are colours amb the negative readings
of colours must go amb the negative feelings of music girls talkytalky about im
readyNest : the laddish ness of lyrical delivery i feel is not softy
softy enough for Girls Sensibilitys evem whem freesung With💖💖💖💖💖💖💖💖💖💖Her innocence........
*tense : where we are in a story : stressed
**I Love DuoGirlyYou
439
service: forcing Girl pigs to be raped
by boars whom are also being raped in indoor intensive farming pig units/farms
by what they call serving them up to the boar or themselves as the so called men
whom are filthy rapists are the ones who grab the penis of the boar in their
hand and force it into the vagina of the screaming gilt or sow: serving up this
is called
440
pimp
438
bare minimum
: sex reference : so called men expect to fuck you
her it
age : very offensive.
herloveage
is ethniceity
enter: like
in lovingly enter a vagina
interr : as
in to interr a rape and murder victims dead mutilated body
fix the
world ruin
heal the
world bring to heel
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
PlanetteEarthMother’sWoombyWoomby
is to be GirlyNestPerfectiomAliKissyCarolineSnuggle
audio note
503 to retrieve from phone: maid in manhattan
i have seen
the filth production notes from this so called movie : notes
explaining intentionly filthy subtext for this certificated pg so
called movie
some of the
following is highly disturbing but all of this was intentioned by the filthers makers
of this filth so called movie
maid in
manhattan : get your man hat/mind/controlled on : be man mind controlled : made
to ( maid is a defeminising removal of e from end of word as in french masculin
ises, forced to work in un needed role, and forced to be a small i : insignifi
cant : Girl : maids are unneeded inhotels and lazy people should clean their
own hotel rooms and leave them as they left them and all staff should change
the bed clothes :ALL : better yet the previous occupiers change the bed linen
and wear gloves too under the scrutiny of cameras in every space im
PlanetteEarthMother’WoombyWoomby
certification
PG
her child
being bullied by other kids to not want kisses from her mother acceptance :
jenifer says mister cool guy : it is not cool to not have kisses : jennifer’s
face is worried so we are being indoctrinated now to accept that mothers being
worried about their kids is acceptable too.
just made it
marissa : maid to be an it : made to be an it
Marr
is her
Jennifer
says a aguy has a nasty butt and that she would kick him out too
: promotion of Girls as being masculin filthers like so called men
man
called god by jennifer and he is cool with that :
we can see
where the subtext of this filth is going
support of
the idea that a maid shouldn’t be able to apply for an assistant man
agers position in a time when this mentlity was gone from the running
of hotels in this state but the film makers wanted to promote the idea it is
still like this: defamation of the character of new york hotels and new yorkers
hotel workers(slaves) : butlers are offered the job but the
member of the man age meant staff(object for hitting someone
with) who says this is openly overtly resistant to a maid applying and very
rude about it.
fukimoro =
fucky morrow = in the future everyone gets fucked = japs eye view
let’s
make sure it is a smooth transition (promotion of adultery support by hotel staff)
presentation
of two Girls as being habitual hotel thieves but so called men
are the thieves of the so called world
assembly man
chris mar shall is the so called man
intended to marr marissas life with masculin filthy filth roman
ce : no one wants to be brutalised with ancient rape sensibilitys : which he is
to assemble around her or definitely assemble her life for her
a regular
customer in the hotel mr new man is a so called
full monty (Girl narrating this obviously for indoctrination purposes) and it
is accepted that he is obscenely and illegally exposing himself in the hotel
and that this is to be found acceptable and funny to the so called viewer
of this filth movie. there are laws in this state to ensure this can’t happen
in hotels accidently and the so called staff would be aware of this as in
specified so this so called man would be arrested : but not in
this so called movie : obviously the film makers
want new men to get away with this sort of
behaviour
stanley
tucci known paedophilia promoter the lovely bones quote
: sentimental favourite chris marr shall
blah blah blah blah : informing the viewer that positive reading of the term marr
is not what the film make rs are interested in : sentimental
favourite chris (christianity) marr (marr
i age) shall (you are my property)
blah blah blah blah(we do not give a shit) :if the film make rs
do not like negative readings then why are they not part of an overt and
publicised masculin movemommed to abolish the so called english
so called language?? and all its marr ia age terminology??
clever boys.
playboy is
apparently a compli meant ha ha ha : acceptance of filth press
filth promotion
listen to
me! im a (pelvic) floor butt ler
heres the
multiple guys
the dog is ruf
us : these writers are filthy filthers : innocence ruth (not
ruthless) is a rape victim of these filthers
look at me!
(rufied victim) every filthy sentence has double filth roman ce
mean ing this is a rom com after all
(romans were rapist murderers)
going to
bathroom alone : i feel queasy
you have my
permission!
call me if
you need any thing : is this supposed to be a joke? (very familiar... is this
scene in another so called movie too where a girl is getting rufied/drugged?)
see audio
note for happenings in toilet
Girl stayed
at hotel: i mean there are limits ha ha ha you really are bad (promotion of
there being no limits and bad as good) anything i mean its up and down (any thing
vegetable animal mineral) : one day we are looking at rings the
next day we are breaking up : so called men like to give two
rings to Girls because the first ring is diamond (objectifcation of clitoris)
ring (vagina (vaginas are actually large baby size 1 shapes)) marr i age
(girl is a small I obviously, if at all) ring then being the arse hole : so
called men have those too
people used
to tie the knot together until so called men forcibly installed
the jewellery con vention of vaginas and arse holes symbology
when they installed bridled whores groomed by animal husbands filthy filth marr
i age con ventions up on all Girls. so called men
who write this type of filth in so called movies have access to
the truth of this information i am telling to you, that has been overtly
covered up through the centurys until this filthy filthed so called modern
day
Girl stayed
in ho tel: 1 L is so called men in
solo domination over Girls : get Girl to tell the Girls : Natasha richardson is
promoting this filth : in this role
more
promotion of infidelity : lunchs : Girls as value
attributioned commodities : going to be late : pregnant with someone else? :
late is a negative phrase : pregnancy is good not lateness : belittling of Love
Amb Fidelity Pregnancy : stockings are named for girls as fuck
stock : I’m right on time for my pregnancy : calling Girls that dress Girlsy nancys
is very offensive and from this term preg nancy
Girl stayed
in ho tel: you’re such a doll : such an object :
you must not object
audionote:
Girl smoking in ho tel : hi where’s the fire : as she against all
hotels’ policys’ in new york smokes in the doorway to the clean linen room :
the pun being the fire reference : considering all hotels do not accept such
behaviour i am not sure why the filthers of this filth wanted to show this
audio note
a quick
aMammalysatiom of the beginning of this filth masculin promotion
rape culture so called movie because i do not have
time...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
i wanted to
show how these filthers think : their overt and very very obvious pressure on
Girls to be raped sluts is an in dust ry
stand ard and an english intelli gent
sia stand ard and has been for centurys : the
depravity found in the deeper meanings of the subtexts in these so called movies
is to be exposed once we acquire all such writing materials from these so
called men of the so called film in dust
ry : filth : if they are not too scared to share them : do not
let any so called men burn any paperwork in the greater los
angeles area.
maid
in manhattan is
a PG certificated so called movie that
childrem can watch in a cinema without a grownup can rent without a grownup can
watch online on youtube without a grownup and it is intentionly designed to
indoctrinate their minds to filth acceptance
people need to
realise these men like to be clever like to think they are clever and they are
filthy and they like every phrase in a so called tv script to have a subtext
meaning and they are writing filth into these subtexts and leaving clues they
think people can’t notice or hope they don’t or as is seen in recent years due
to the criminal cabal they have over all media and the inability to get legal
recourse they are being just as filthy as ever and even more so and do not care
if people do notice as there has been no recourse: obviously GirlyBubbaPeomple
have gone to the police and they have been unacceptably told to go away.
441
443
444
447
448 see screenshots
x3 is it not law that the bbc must present the bbfc
certifications? with a simple guidance rating it is a overt attempt to allow
kids to watch these unsuitable films: in russia this so called movie blade
runner 2 is 18+ but being one of the most violent disturbing movies you could
watch the bbfc gives it a rating of 15 which i consider to be an
illegal interpretation of the violence in this so called movie.
479
first knight reference
name first night of guinevere PG
U prince of egypt
lethal weapons brandishing at start of so called movie features mother
abandoning her baby to crocodile infested waters without any immediate threat :
never happening : equine enslave men t with dangerous chariot
chasing over collapsing scaffolding and this scaffolding holding great big
stones collapsing and men falling 100s of feet to the deaths and then the two
anti heros moses and his brother rameses laughing about this all in the first
five minutes then a collapse of a giant sand mound that covers and suffocates
to death a group of innocent people that moses and rameses find hilarious: how
do the bbfc think they can get away with classifying this filth so called
murder bullying rape promotion movie as a U ?? how do you so called men of the
so called world think you are going to continue to wholesale
media blackout all girls protestations and threaten girls into silence if they
complain? this collusion is so overt and obvious and you so called men
are about to removed from all power forever! this so called movie
is a filthy disgrace and was intentionly rated wrongly by the bbfc as a U:
illegally: a silhouette of a naked girl is featured kneeling in wait on a bed
and turns out once the curtain is pulled back to be after us the audience has
to take a second to figure out that there isnt a girl tied up on the bed but a
man with naked elbows not breasts tied up on the bed : filth subtext references
feature in this filth so called movie : please do not watch this
horrendous so called movie : a so called movie for
kids next has a so called man pushed by the anti hero to his
death off of a hundreds feet high scaffold to his death : at this point after
seeing this overt filth and having enough of the filth subtext
GirlyBubbaPeomple turn this filth so called movie off and so did
I : now is the time to determinedly legAlly arrest these filthy so called men
who classify these filth so called movies as suitable for all
childrem and prosecute them with accurate readings of the present Laws that are
in place for the protectiom of childrem but are flouted illegly by these filthy
filthers.
452
462
463
465
469 satellite imagery
for solving crime
470
472
473 he understands
this but maybe did not think about the ramifications of information being
presented in this way and how it builds a picture of lack of safety in a macro
AMammlysatiomEllaLoveScape
474
476 moremumtum
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
we can’t be negative
about wearing dresses in front of our childrem at all so saying you do not like
to or you are not confident enough to wear a dress or that dresses are not for
you or not your style is to be illegal in front of your childrem whom are to be
wamting you to wear skirts amb tights amb blouses of course, because they are
to not have any concept of prejudice.
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
you are a girl amb you
cam choose what you wamt to wear, but you cannot put negativity onto others
like your childrem or girlypartma amb going forwards we are to remove all
prejudice completely. but we do have preferences but the girly requiremommed to
be without prejudice instilling upon childrem amb your girlypartma is am issue
that girls are going to decide upom all the girlynest legislatiom for to
protect girlyyumyum sensitivitys amb sensibilitys from being indoctrinated to
trauma reactive positioning. being happy to try new dressy ideas amd not be
prejudice is a love that for older peomple whom have been traumatised into
being fearful and negative about trying new dressy ideas might be difficult to
accept amd older couples are going to need time to adjust amd ultimately we
need to be happy to try new ideas but privately what we like to wear is decided
by two girlypartmas together: im fambily spaces the need for nil negativity
requires us to be happy to be excited about any dressy uppy ideas for our
childrems girlsydreamsyfambilymummas’bubbas’alikissycarolinesnuggles : we are
all girls amd girls do not strap down their bosoms because breasts are special
amd not to be harmed by putting them in chains. wearing cosmetics amb skirts amd
blouses is fun : wearing girly swimsuits amb dresses amb wigs is fun amb high
voices amb deepened voices are girlynest fun.
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
girls already dress
like boys amb so called men find this arousing........but boys
are bullied to not dress like girls despite the fact girls find this very
acceptable to their girlsydreamsywishes
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
girls find their
girlypartma dressing like girls very beautiful ambe sensuAllyPerfectiom ambe so
called men are to realise that being attracted to girls is about
all forms of femininity.
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
you are a girl amb
you do have a vagina, a duovagina, amd you cam choose what you wamt to wear but
putting prejudicial thoughts on others is to be a very important comcern for
girls to decide upom during the girls girlyest of girly TheGirlsGirlyestOfGirlyFullGirlyFeminisatiomOfGirlyRealityGirlynestAliKissyCarolineSnuggles
AliKissyCugglyWugglyJigglyWigglyGigglyHugglyCugglyWugglySnugglyBugglyBoo🌈🌈💖💖🌈🌈FullGirlyCulturalGirlyAuditGirlyNestForEverGirlyFemiaEspressed💖💖NannaSnuggle
what happens in
private spaces private dressy uppy yumbyumbtimeb with you amb your girly partma
is yourlovejoy amb with girlymindlimk you cam feel each others loves amb
preferences joys amb our preferemces for our girlypartma’s dressyuppy fun is a
joy for us to fullfill for her:
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
being a paremt is a
special responsibility amb we cam not show any negativity to
girlynestjoyimsistermces ever im front of our bubbas........their minds need to
be completely protected from any negativity at all
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
amb the completekissofgirlynestkisssistermce
needs to be completely freed from prejudice with preferences being all
imclusive ambe every bubba of a fambily cm have her girlsydreamsywishes for all
her fambilys’ dressyuppyyumbyumb fully fullfilled.
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
amb private joys
being lovingcaringcomsiderate : we can never expect our girlypartma to not
lovelivelove their girlypreferences but we have to understand that our
gilrypreferences are for our girlypartma’s girlypreferences to be comsiderately
fullfilled fully too as this is our joy :
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
ambe our bubbas
always having their girlypreferemces is our joynestalikissycarolinesnuggle: to
teach them that all their girlysdreamsywishescometrue amb for them to get used
to this girlynestdefinitude : imsistermce : amb that their preferemces imclude
ours too : pink dresses today for bubbas joy : yellow dresses tomorrow for
mummas joy : pink amb yellow dresses are every fambily perdaughters’ joy
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
being open to
learning new ways of dressing im private livelovelive timebs is the joys of
both girlypartmas being completely fulfilledfully as per their
girlsydreamsywishes
💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖
to place
check the yum written about being safe to walk
anywhere without vision, did i momtiom walking im silence too?
SumYumYum
imstead
of control paste i say cuddle kiss
imstead
of enter we say love
imstead
of return we say alisnuggles (canines prefer lovesnuddles to com man
ds)
imstead
of backspace we say birth
imstead
of delete we say cuddle
imstead
of escape we newkiss
cameras underwater in every swimming pool with
computer safety amb lifeguards always on shift
bans on walking in storm weather : lightening risk
and lightening strike risk protocols for when you sense an imminent strike :
drop umbrella amd drop to ground. drop immediately to ground and lie flat :
this is a compulsory govern mental GirlyNestImformatiomVisuEllaPresemMommedsiom
That Does Not KissSist whem you search this subject on the filth that is the
inter net : if you feel static a lightening strike is immediately
imminent and there are faked videos with people with their hair on end that has
been staticly charged by other means to fake the video : this makes
girlybubbapeomple think they have plenty of time and i even found an official
.gov page that said if you get staticly charged in a storm move inside but this
risk is so imminent you need to take immediate movemommeds to safeguard your
life. being struck directly by lightening kills you 100% of the time : the
chances of survival are nil because the damage done to your body is catastrophic
: even if you were without shoes and socks with very good contact with the
ground so your feet were not blown off the electricity does leap from your
hands and does blow them off : the internal damage is mortally severe : sorry
for the graphic descriptions : immediate GirlyNestLegislatiom as asked for by
generatioms of feminists already, is to be implimommeded with out delay to
fully ban all GirlyBubbaPeomple from being outside im lightening storm risk
weather : the lack of convenience that men so hold dear
in their money forcing monoply filthdom is to no longer stop Girls from
protecting every bubba that dies daily from lightening strikes : TotAlly
avoidable deaths