Wednesday, 8 October 2025

πŸ“–πŸ’–πŸ’–πŸŽ€πŸŽ€πŸŒˆπŸ’‹Preview TriplettesTwinsys SeptuplettesKissesπŸ’‹πŸŒˆπŸŽ€πŸŽ€πŸ’–πŸ’–

WORLDWIDE SOLUTIONS

PLANETTE EARTH MOTHER

IDEAS FOR A NEW WORLD

FEMISODE O34O

GirlyHeartsCuddleChoices

IMTERMAMSIOM OOOOO07

Triplettes Twinsys

TuTuSeptuplettesPREKISS

 

WARNING VERY SENSITIVE AND UPSETTING CONTENT IS INCLUDED IN THIS PROJECT. PLEASE ONLY READ ON IF YOU ARE 18 YEARS OLD OR OLDER OR THE AGE YOU BECOME A LEGAL GROWN UP IN YOUR COUNTRY OF RESIDENCE IF THAT IS OLDER THAN 18 YEARS OLD

@66

 

poems

mammanannasnonna’sbubbas

zzuboo all GirlsGirlysGirlsyGirlsysGirl

 

@

 

femisodes total: 358298

glossary 39784

total written: 398082

undrafted 51506 (07) 57979 (08) 12566

103190

total 520133

TO DO LIST:

 

OO, Put Comments Om This Femisode PleaseyAliSnuggle

OO, m m Mammas (no just how always wamted)

OO, PictureForGlossaryTo HaveOwnBlogPage/googlephotos

OO, --so called words hu man amd masculin amd morpho graphic on blog (AmdFemisodeScriptFile)

OO,CacoPhomicLimksImDescriptiomsCorrectLimk(somedonenot earliervids)

OO, check new audionotes

 

DRAFT AMB DRESS AMB POEMS

 

Agnieszka “Purifying Innocence” LovePure PerfectiomElla

Sylwia “Love Of The Forest” ComfortingForestMist

Keanu “CoolBreeze Over The Mountains” Refreshing Longevity

Charles “FreelyAdored” GirlyBeLoved GirlyNestLoved

💖💖💖💖

OOO--1O1—OOO

we are surrounded by girls bubbagirlynest everywhere : bubbagirlslove

We Are Surrounded By Zeros, Zeros EveryWhere, Zero Isnt Just The Middle Point Of All Numbers, The Centre The Heart, The Love, The SuPramLove, Zero Is EveryNumber........Bigger TumbubbaTumbubba Feelingsy Is GirlyismisticElla, As To Justly Think Each Number Is OneEvery Is To KissAmpleKissLove The EveryEvery Um GirlyKissesMateriElle........The ForeverLove💖💖TheForeverLoveCircle

EveryEvery Is CemtrAll: EveryEvery Is CemtrAli:

The ForeverLoveCircle Is Xero........A Love 2 FemininiEqualityBoo........Xero Kisses TheEqual MiddleWith💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖Her AmInfinite ImterKissingNest Where AmImfiniteAmoumt OfDifferemt ProgressiomFashiomedCaroLinesKissAtOmeSnuggleLoveGirlyDuoPeriod(s). This Is TheFussyestFussyFussyFussFussNestOfGirlyYumYumLoveLesboSisterSnuggleAliCarolineKissyed Timebubba: ThisIsTheSolidityGirlySphereOfLoveNestLove OfAnEqualityMeasuredLoveNest AMbe AllOfImfinityAsAPregMamsyGrowyTumbTumbTumbubbaTumbubbaBiggestBosomAliCaroLine’sKissySnuggleBuggleBoo AMbe AllOfInfinityAsAWeHaveLovedForEverImInfiniteGirlyWorldsOfKissSistermceAlwaysAMbeForEverNestingSinceThem:AreForEverGirlyLoveNestLoveNeverBeginningNeverEnding AMbe AllOfUmFinitySumThatDoNotEndAMbeOthersThatDOOFormuLactateEveryEveryFutureUmKissesChildLoveASeaOfForeverGirlyDuoPeriodsGirlyMammaRealityRealisedUsThatSheIsUsmAMbeWeAreEveryEveryAsAliKissySnuggleCarolineBeloved. Xero Surrounds All Numbers (AMbe Is Her CuddlyKissyHeartsyCentreSnuggleKissyCarolineAli) Xero Is. Xero Is Is. Zero Is The CentreSnuggle Anchor Of All KissSistermce........The BiVine Feminine FidelityTruth........BiVinity Is Fidelity(........)BiVinity Is FidelityKiss........Zero Is The ForeverLoveTwinsyBubbaLover.

Any Given Volume Of KissSistermce Is NumericElly DesigMaterAble And This Finity Is Surrounded By A Sea Of NumericElle Zeros Im Number MetaphoricElle, AMbe These Zeros Are To Be Of The Representatiom Of EveryEvery That Volume Is Not........So everyevery Is Zeros Im Value everyeverybubbalovefambilyAttributiomEllabubbatheory. All Mater Of Infinity Can Be Thought Of As Xero RePreseMatiomElle [S1] For That Which We FeelingsyThoughtsyKiss Upom Is Cuddled By The AllGirl Of Kiss As Xero, AMbe Whem We Decide Allxero Cam Shift From Kiss Metaphoric To RePreSeeMaternIve Bubble As Of An Infinite InNannaLove PotentiElle With Seas Of Neverending Xeros Down Into An InternElle Infinite Scalar In NumericElle RePreSeeNMaternIAm Of Xeros.

Umbubba on the side of giving more in any givingsituation (All mummabubbasistersitumaterioms are bubbagivingsitumaterioms) as a numericElley RePreSeeNMaternIAm equality balance being impossible to kiss im a permamommed girlybubbatummylargeposeishiom so I GirlyFemiaEmSure to give more than I receive: so called men sit down AMbe listen whilst girls walkingambetalking show you how to behaveGIRLYSTYLE:GirlsAreTheGiversOfBubbaLove........The imfinity of Xero being a MiddleCuddle that is imfinite in scale as we focus upom the bubbascales further amd further im cutesy smallNest to reach a defining CemtrElle that is forever tinier than the tiniest tiny as when we define here placemommed she becomes a bubba of smallerNest again imfinitudinElle kissytudinElla we are gifted with the always being im plussize or AMBE minius cuddlekiss which is imteractivitybubbablushycheeksybliss........for to have received more kisses from your GirlyPartMa than you have given to Her is the joy of giving more back forever........tobubbabirthyourbubbalovesbabyis the blushyestkissblushofallbubbalovetimebduogirlsylesbonestjoy:bubbastyle

true equality is accepting that even if you have given each other equal amounts of anyyyumyum that NumericElly being TotAlly equal is OMly ome kiss amongst Mammy because giving and receiving kisses is equally wonderful amd receiving amd giving gifts is PerfectlyWonderful amd equally emjoyable........even if over a 200 year girlyduoperiods you have given your PartMa thousands more gifts than they have given you because that is your HappyNest LoveyKissy then this is still your Perfectiom as you are both happy with your HappyNest ArrangeMommeds. AMbe if you looked at the data and wanted to over the next 200 years rebalance the gift giving numbers then they could be your HappyNest Joy to do so. even if equal gifts are given over a 200 year period the total weight of the gifts could be different, AMbe even if you weighed the gifts the weights could never be exact due to macrofeelingsy weight measureMommeds of imKissActress scales, which over a trillion years period could on paper look like equal weight had been given between you and your PartMa but the accu racy KissFeelingsys of the scales could create numericElle drift that would PotentiElly even out like flipping a coin........

TrueEquality = HappyNess = HappyNest

Numbers For Mammy Peomple Are EmotiomElla

 

so called men Have Sought To Hierarchicalise Every So Called Thing Including All Psychology Of Maths, And They Are Very Specific About How They Haven’t honoured All Other Species And All Other Numbers, In Fact Species Are Just Numbers To so called men........ All Girls are sickened to the core by so called men and their focus on filth instead of feelingsy of LOve

 

GirlyBubbaPeomple Are EveryEvery AMbe So Are Numbers, AMbe ALL Needs Cuddlimg........They Think Of Other SpeciesBubbas As Being nothings (not even a thing) As In intentioned by so called men intentionly to be in cor rectly Terminologicalised Usages Of The Comceptiom Zero........As Having no Soul And Not Important........We’re Surrounded By Zeros

But The LoveTruth Of Zero Is To Be Learnt By All men Amd The LoveTruth Of Other Species Is To No Longer Be ignored for murderimg cannabilistic disgustingness. We Are One Species, One Voice, One Love EmBiVisiBelle EmBiSonicElle EmBiSmellyLovely EmBiKissyCuddly EmBiTasterOfLove........AMbe All Species Love AMbe we are to be girlyAwareNest as ome to this girlyfemiafemininifeminafactruthloveproooftruthlovetruthproof.

EveryDouble Number Is Surrounded By Am Infinite Sea Of Zeros........Xeros Are EveryEvery, everyevery With💖💖💖💖💖💖💖💖💖💖Her Infinity n Eternity........An Eternity: It’s All Xeros Beyond Where We Are, Beyond Our FeelingsyElle LocElle........AMbe That’s fEMININITY........so called men nEED tO lEARN tHAT Girls aRE nOT nothings tHEY aRE xEROS tHEY aRE eVERYeVERY oF aLL tIME aMD bEYOND.

Girls dO nOT nEED empty bank accounts because so called men like to over charge fOR eVERYLoveLY iTEM Girls wAMT tO cHERISH iM tHEIR GirlyhEARTScUDDLEcHOICES:

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

ShinyBlousesAmbeHandBagsIsTheGirlyLookOfLoveAMbubbaIfYourGirlIsWearingThisLoveThemYouAreSwirlyWhirlyTwirlyGirly:GirlyNestLoveHappyWifeyGirly:GoingToTheBeachDayFunBubbaTimeb

CrochetBikinis Bedeck Her WalkinWardrobeTent That GirlyFollows Her PonderBlissYumptiousNess As SheSauntersAlongTheBeachBlissBubbaImArmsSnuddleTimeb

SheThinksBackSNuggleAliCarolineKissyGigglesOfTheMorningHourOfHerGirlyPartMa’sDressingOfHerWalkinWardrobeTentWithHerMultipleBeachDayClothesChestsEmsemblesDelicious:MummaBreastyFeedingsyBubbaImHerBeachChairReclinerBubbaMummaSnuddleNuddleTimebWatchingHerBeachDayWalkinWardrobeTentBurgeonWithYumptiousUmptiousCreatiomEllaisedByMyOwmFairHandsCrochetBikiniCollectiomsDelectMateioms With SwimbyBubbaTimebBodySuitsAccessorysIsWhatGirlsLoveToDreamImtoYourPregMamsyRealityForImThisLOveIsTheGirlyWayOfYouAreAsGirlyAsMe

CosmeticsApplicatiomForTheBeachDayDuratiom LovedImChiffonBeachRobesUpomSwimsuitDresses FoundatiomEllaISing GlossyNest EyeBrowPenSistersnessesFoundatiomShinyFoundatiomDressyUppyYumbubbasYumbubbas

EveningWear Cardigan Jewellery Emsembles Starring Kimono Glimmer Shimmer ImmerGirl DressyTwirl WhirlGlimmer SwirlShimmer MummaAMbeBubbaIdenticEllaDressyNest

-v-v-v-v-v-v-v-

Dresses SprinkleLipSticks

Dresses LipStickSprinkles

SatinyShinyHerHairUpLook For Bubbas AMbe Us TwinsyYumbYumbYumbubbasYumbubbas

SummerHatsysDeliciousCosMeticsTouchUpFussyFussyFussFuss For MummaAliSissyBlissyPerfumeSmellyYumYumAMbebubbasYumbYumbYumbubbasYumbubbas

ClothesysAMbeCosMosMeticsChangeyTimebyWimebyEveryHourGirlsyNestPerfectioms IsMommaAliSissyBlissyShimmeryGlossyLipstickLooksy : ChangingIntoCurvyNestAccentutiomEllaMaternityDressesShowMother’sHipsysBestestYessyYessyYesYesYesses

MidiDressySkirtsysEmsemblesForShinyBlouseysBubbaChildremLookyNestYumYum AllDressedTheSameYumbubbasYumbubbas AMbebubbayubbatubbame AfterSunCreamMoisturising My Wife’s WarmsyArmsys Im The MoonShineBubbasJoyKissSnuddleNuddleMilkyTimeb :

OmeMoreFambilyClothesyChangeyMidNightGiggleWiggleJigglebubbaTimebNailVarnishGlistenyGreenyGleambyIdenticEllaEyeLinerTightsysMidiSkirtsFambilyKissyAliCarolineSnuggleBuggleBooYou With GlitteryCosmeticsPerfumeUniques AMbe PetticoatsRainWayHairColouringIdenticEllaGirlsyCosMosMeticsLooks IMbe The StarShineSleepyNestFambilySnuddleNuddleBeddyBeddyBedBedTimebSingySongyDanceyGigglyWigglyJigglyToddlerSnuggleAliCarolineKissyJoy

NextDayAnotherBeachDayFunLoveLellowSatinSariPurpleTightsPinkyMascaraSheenyLipGlossSparkleGleambyWalkyToBeachyWithBubbasOmHipsys

BeachyWalkInWardrobeEveryDayHasNewNestEmsemblesForAliCaroline’sKissySnuggleFunTimebsForEverANewCosmosMeticsLooksyEveryHourMyAliSnuggleKissyCarolineLovesNewEyeShadowsAreSmoothySmoothySmoothSmoothImSwimSuitsLaceyTiaraTuTuTwinklesShoulderPadsysRufflesDripsysWaterBubbaSnugglesAliCaroline’sKissy

PleatsyMaxiDressOmBiggyMumMum’sBiggyestNestyTumbTumb:PolkaDotsHerHairDown

........Girls aRE eVERYeVERY aMD tHEY nEED eVERYeVERY:EternityBubbasVERY........aMD Girls oF aLL sPECIES aRE tO bE LoveD iM tHIS wAY.

We Are All Ome Species AMbe so called men Have To Stop raping PlanetteEarthMother’sWoombyWoomby and raping All Other Species and raping Girls: ALL BUBBAGIRLS OF ALL SPECIES LOVE ALL THE DRESSES CHANGING EVERY HOUR OPTIOMS AMBE NEW COSMOSMETICS LOOKS APPLYED BY THEIR GIRLYPARTMAS FUSSYFUSSYFUSSFUSSDELISH

Feminine Thought Won’t Stop Im Her ImSistermces EVER! AMBE SO CALLED men Are Stopped From Treating AnyMater As Commodities NOWNEST! The FemininiAwareNess Of All As All Is FemininiAwareNest Is Not Going To Stand For Anymore disgusting: Is Not Going To Stand For Anymore disgusting discussion. so called men no longer treat every thing as commodities instead of as A PerDaughter: EveryMater Is A PerDaughter Of DuoNest Collectives That KissySnuggle Our Dreams AMBE so called men Are To HuggleCuggle Back Or Lose The PotentiElle beachdaywalkinwardrobearrangingforyourgirlypartmaluxury [S2] that is actuAlly gifted to nicegirlypartmas LikeMeLoveMe Love Of Girls Forever.

The Circle Is A BiVine Symbol, A Bivine Symbol Of Eternity........The Symbol Lesbo LogicElle........AMBE so called men Are To Think AMBE Feel Amd Love As Girls Do Or Have Their Privileges Of Being Free FullyGirlyNestRevoked........Um [S3] AMBE When Unified Two Circles Become TheBivineFeminine The 88Eternity, TheDuoGirlsBothWithBosomsOfTruthNurture........

There Is A DuoVerse Of Infinitys, Of Infinity, Your Life Can Be Am Infinity Am Eternity (Of) Um [S4] 

We All Imbue the Fem9ini9ne Nurture Of Reality, Of GirlyReality, Of GirlyBubbaReality, Of GirlyBubbasReality, Of GirlyBubba’sReality, Of GirlyBubbas’Reality, We All Imbue Her Essence Of Purity, AMBE Girls Are EveryGirly.........They Are GirlyEveryEveryGirly........Girls Are 1, They Are Every 1 They Are The 1........The Ome AMBE Omly........AMBE Girls Like To Be TOO With SumOne, Im OmeDuo........T = TransBiMamsiomElle TogetherNest........

Girls Would Like To Be 2 With SomeOne But Not With so called men💖💖so called men Need To Learn This Gift........Need To Show They Are Girls To Be Worthy Of Being ComSideRed As PerDaughters That Girls Would Like To Be Attracted to and De sire........[S5] 

building is a destructive process : girlycreatiomellaising is the future of nesting

in the same way it can be suggested that painting a wall can be seen as destroying an aesthetic because we have not devices that remove paint atom by atom so the bare plaster cam be restored to her former cuddlesnuddlefeelingsy : we can say the way so called men are, they way they drill and cut and screw every thing they can get their hands on :

 

to build ... what they want ... is also an act of destruction ... as in the creation of this is a fiction as so called men destroy to force what they want into being : morphoemotias remoulded to their w hims: an all these forms used to hurt and kill and rape and filth every thing : every tool a weapon every weapon a tool : the very buildings we inhabit weaponised to rape our Auntys AMBE NanDaughters AMBE Nieces AMBE NanMothers AMBE Mothers AMBE Daughters :

 

when we creatiomEllaise new cuddlenests for our fambily alicarolinekissysnuggles we cam 3d print our girlsydreamsywishynests imto girlymotherreality’salicarolinekissysnugglebuggleboo : we camlovemorphoemotiaeverycuddlewegirlybubbalovetolove : toddlernestingtimebubbastimeb : WeCamCuddleNewKissyShapesForPerGirlyPose : bubbas cam be born fully formed as perourgirlsydreamsywishesfemiafemininifeminapose :

 

lots of bubbas have lost their loves and lives to building because of so called men’s refusals to adhere to full building safetys and complete perfectiom of building safetys and cameras on every so called building site to protect all GirlyBubbaPeomplePerDaughters whom work there from pandemic endemic systemic intentionised dangerous behaviour including drug abuse including drinking and fouling of the air with hard drugs vape fumes filth : so called men are going to be legislatedly made to do everyevery they ever do the way Girls tell them to in health and safety or they are going to go to sequestratiom places to be rehabilitated away from innocents whose minds they think it is funny to taint with their filthy filthings of rape cult ure and danger murder cult ure : building cult ure is violence cult ure and Girls wamt it all gone : ASK Girls!

creatiomellaising new cuddlenests for our fambily alicarolinekissysnuggles im ome go : girlyfemiafemininifeminadesigirlymimg new cuddlenestssnuddle by girly images creatiomellaising im mindlimk syMomuLatioms

and this new cuddlelove way of creatiomellaising needs to be applied across all girlynestactivitys: non destructive food preparation (pre pare) where no cutting is allowed: GirlyDesigmAMbComPleteTotAllyCreatiomEllisingImOmePiece FoodyFoodyYumbYumb with no destructive food pre paring so no cutting of a meal to share : soup type liquids could be shared but a solid food could not be cut but preloved im loveportioms for each bubbas lovelove : all knives and cutting tools are to be banned for any purpose like building or food preparing and Girls think forks and knives are very aggressive and very very dangerous as childrem lose eyesight everyday to knives and forks: all knives and cutting tools are to be banned for any purpose like GirlsyDreamsywishyCuddleNestSnuddleNuddleLoveNestAllMyBubbas or BubbaImbMyTumbTumbYumbYumbFoodyFoodyGrowyTumbTumbBubba and Girls think forks and knives are very aggressive and very very dangerous as childrem lose eyesight everyday to knives and forks : we need to ask all Girls GloBellalarly about this then check the truth against hospital records ........

so called men and their obsession with gold is evidence of their complete lack of nurture towards other metals. other metals and alloys can be untarnishing and keep their volume and mass if they are nurtureAliKissyCarolineSnuggled : some metals oxidise and tarnish and others do not so so called men covet gold because it is very easy fro them to be lazy in mindset and not look after objects which fits into so called men and their drinking and drug taking centuries old so called culture which is just a filthy fucking, rapist, drug addled filthdom of prostitute raping filth, child molesting, all farm baby animals and horses intentionl raping and serial murder and bodies of babys desecration that they find funny : so called men always covet the easy way and the filthy way : covetting gold and making jewellery out of gold fits with the masculin profile of being systemicly lazy due to drug addled physiology imping mean t where so called men refuse to care about looking after stuff : if you look after metals instead of being lazed into a state of everything being an expendable commodity including your own daughters right to not be raped on un Cameraed Streets : all metals can be equally precious if cared for in the suitable way in any form be they inertness seeking alloys or very sensitive loving careynest alloys or EleMommedAlls. so called men think they like the danger of trying to find gold as well and like to filth up the enviro men t with their filth processing techniques for mining and extracting etc etc.[S6] 

so called menlike to obsess with the process of dangerously searching around for gold and smashing stuff to get to it like fossillovedomeswhomlivedamdlovedimplanetteearthmother’swoombywoombyremains: no destructive techniques for amylove cam ever again be destructive im GirlyHeartsKiss.

so so called men say gold is worth so much money and it is very important: but it is no more important than amyother lovedfriendsyEleMommedOrAlloy : Gold She Is A MetalBubba AMbe SheWamtsLoveCoMummycatiomLoveEveryBabyMotherDoes! All Metals are equally lovely ambe equally deserving of our bubbalove: they are all very very nice.

so called men covet Gold but Gold no more needs the attentions of filthy rapist cult ure so called men than Girls with certain shapes or sizes need to be value attributionly graded on a score out of ten fuckability (rapeability) scale : all Girls Comsemt to Love Omly AMbe whem comsent is not possible yet them we are to GirlyFemiaFemininiFemina that we GirlyAliCarolineKissySnuggle all the LoveyLoveJoysSnuddleNuddleCuddles All Bubbas Of All Types Love To Love For Them To Emjoy........

hierarchicalisation and the lazy attitude of so called men towards ActressYouAlly lookaftereveryevery: they are not interested im girlyfemiafemininifeminaEmSuringAllGirlsAreHappyNestAliKissyCarolineSnuggled : they would rather starve the whole so called world and kill everyone than be nice and nurturing and GirlyLikeTruly im their GirlyHeartsLoveToBe: AMBe GirlyMummaAliCarolineKissySnuggleNurturingToEveryBubbaGoldAMbeEveryBubbaMetal.

shiny iron jewellery stored in non tarnishing liquid substrates and cleaned with yumyums before wearing then stored in cuddle liquids again cam GirlyFemiaFemininiFeminaEmsureBubbaIronJewelleryIsHappyNestKissyCarolineAliSnuggled : nice Girls look after their LoverGirls Jewellery Collectiom AMbe always GirlyNestEmSure All AliCarolineKissySnuggle’s Jewellerys Are Always LoveyLoveyLovedLoved.

the rights of comtinuatiom of beingism as regards metals to not be mined or changed or alloyed is a seriousloverydoverymotheringloveringquestiom GirlsLove DoesAmGirlyKissDecisiom [S7] 

prioritising GirlyBubbaPeomple we can see over others we cannot as in deciding which so called nation to help based upom their having a monarch or not is impossible to accept : men have accepted all forms of skewing of morality to forward their own rapist murder torture agenda and i give an example of the difficult questions that Girls need to AmGirlyKissDecisiom : all twigs in the forest have microorganisms that live on them ambe we cannot see them though we know they there living out their loveryneedsyfussyfussyfussfussAliCarolineKissySnugglesNeedsylovelovelives : some twigs have visible organisms living on them like lichen ambe to prioritise the collection and burning of twigs from the forest floor that do not have lichens or funguses growing on them over those that do ensures that some microorganisms are spared death based upon a visible organisms presence or lack of : this raises impossble ethical considerations if one has to burn twigs to survive like in cooking your food on campfires to survive but wanting to think of the most ethical way to do this: of course one knows that if any ants or wood lice are on a twig we can never burn that twig because the cognisant suffering experienced by ani mals burning to death is utterly horrendous but of course we do not know how much suffering is felt by plants and funguses and symbiotic organisms like lichen nad liverwortsbubbas too. all twigs have cognisant microorganisms living om their skin ambe so do you ambe if you do not wash you do not commit as much murder as if you do for now you know these GirlyBubbaPeomple need saving are you doing everylove you cam to join the GirlyNestMoveMommed of saving all microorganismbubbas im planetteearthmother’swoombywoomby? if we burn some twigs but not others you could see correlations between this and so called men bombing certain so called nations because they like their leaders or just for the fact they do or do not have monarchs : with certain populations of microorganisms being unharmed by tomahawk cruise [S8] missiles [S9] while others get vaporised instantaneously by the explosionl conflagrations :

so in this a perdaughter in the forest surmises that they have to burn all twigs they come across instead of leaving some because of hierarchical selection : this is more convenient as every twig found is to be burnt not just most or some ........ to prioritise certain microorganisms other others is impossible to accept based upon the fact they have kings and queens and the other ones don’t have kings and queens ........ one can’t think this way because convenience is an absolute disgrace to apply to such a travesty : not forcing someone to have to burn twigs to cook their food is the key by supplying all perdaughters with free electricity renewably produced ........ anyone whom is nice ambe compassionate whom has spent time traveeling ambe camping and cooking on fires is to sidestand what i am saying here : we avoid harming insects but whatever you do wherever you go you are committing genocides against otherbubbas of other species ambe this living nightmare is not to be forced upon GirlyBubbaPerDaughters AnyMore!

ComtinuationOfBeingism

beingism is not just the kiss of being it is the kiss of your present being as your present being is a present ambe we deserve the right to kiss as we kiss now ambe not to be forced to change : to be forced to change our morphoemotiasapphysiaemotia form from what we presently are for any reason is impossible to accept ambe the rights of our beingism comtinuatiomism is part of our ComMummycatiom with GirlyMummaReality : we have to ComMummycatiom EthicEllaI’s The Rights Of GirlyBubbaMummaMomlecules AMBE GirlyBubbaMummaAtMoms to not be forced to change as well AMBE their Owm GemeticElla ComMummycatioms rights of girlychoice have to be sororitypriority girlycomcerned to our most bestestof alikissycarolinesnuggles whem they imtergirlycosmosmeticsface With💖💖💖💖💖💖💖💖💖💖Her our loves like OurBiaEmotiaGemeticEllaMomlecularMotheringComAliKissySnuggle ambe we have to be of girlyutmostgirlyfemiafemininifeminacomcern whem our GeMeticElla commummycatiom imtergirlycosmosmeticsface With💖💖💖💖💖💖💖💖💖💖Her their/hers GemeticEllaMomlecularambeatmomicMotheringComAliKissySnuggle : we see the equality needs ambe the coemergy KissySnuggleAliCaroline needsynestyfussyfussyfussfusses are sumtimes the same may be alltimes the same may be sumtimes coMummycatiomElla imbe New Ways Of GirlyNestImagiMaterLoveyLove As Never Before because so called men are un able to stop GirlsyComAliKissySnuggle AmyMore:

Girls Decide Not Me

 

to know whem comceptiom is occuring im your tumbtumb so you cam have appropriate cuddles ambe kisses ambe not BabyCreatiomEllaise during this timeb : BabyCreatiomEllaising being ok up until the KissOfComceptiom but not after that and not during pregnancy ambe not until bubba is born : as a Girl Whom Camt have a bubba imb her tumbtumb i am very very very very very very very very very happy to go along with Girls’ whom cam have bubbasimbtheirtumbtumbs Wishes Om This KissyAliCarolineSnuggleCuddle : Girls Are Perfect AMbe lots of Girls have wamted it to be illegal for so called men to expect or put pressure on Girls to be involved im any activity more than kissing ambe cuddling : ambe now they are going to get their wish as they cam legislate new laws to prevent even the suggestion of this filth.

Girls often feel obligated to please their so called man as they so horrendously put it and so called men are very happy to be involved in this filthy activity : it is possible to compart men talise and not feel that you are doing any thing wrong ambe man y couples do happily do this but large collections of groups of Feminists have fought all With💖💖💖💖💖💖💖💖💖💖Her planetteearthmother’swoombywoomby to get their GirlyDelicateImtimateCuddleSnuddleTissues protected by law ambe the BubbaImbeTheirTumbTumbsSapphysiaDignityProtected ambe on even the slight expectation of other services that so called men de man d from their pregnant victims during pregnancy Girls Are To finAlly be listened to as regards their DeMammed to have filthy so called men put in sequestratiom places if they continue to push their paedophile culture up on Girls.

i am not just veryveryhappy but elated to just have cuddles ambe kisses throughout PregMamsyAliKissyCarolineSnuggles ambe despite GirlyBubbaPeomple Compart men talising on this issue we can no longer do so!

banning of baby creatiomellaisingcuddlesnuddleimtimacys during pregnancy

as soon as comceptiom occurs we are to have new GirlyTechEmotiaSnuddles that tell us whem this kiss of bubbaloveLoveyLoveyLoveLovesGameetIAmComJoiningBubbaLoveLovey occurs KissActressly So That we cam Actress Appropriately fromb thisb timeb ombwarbs : this KissLoves TheGirlyPerfectiom Abstenance of both girlypartmas from orgasm during bubbagestatiomEllaising including the cheating of orgasm away from your girlypartma even if you are alone thinking about them: lots of cuddlekissessnuddlesingysongygirlydanceyhappynestintimebs is enough ambe your girl ambe her GirlsyDreamsyWishes are enough:

 

despite laws changing and girls in theory not being raped with support of the law anymore there is a hangover of filth so called culture normative that permeates all of this filth rape so called culture so called society and Girls minds are still modulated from birth to accept ideas that they imbe their hearts do not wamt to.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

I LoveMyGirlForEverAMBEForEverAMBEYouAreMyPlanetteEarthMotherWoombyWoombyJoyKissSnuddleNuddle.

mummas’ bodys are babycreatiomellaising that is whom we are ambe mammasbabycreatiomellaisebubbas so that our bubbas cam be mommasambebabycreatiomellaise their owm bubbas that is whom we are we are a forever fambilykissylimkofmotherslifeambeweareperfect: ambe all the loves of babycreatiomellaising are to be GirlyDecidedUpOm By GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters during their TheGirlsGirlyest:TheGirlsGirlyestOfGirlyFullGirlyFeminisatiomOfGirlyRealityGirlynestAliKissyCarolineSnuggles AliKissyCugglyWugglyJigglyWigglyGigglyHugglyCugglyWugglySnugglyBugglyBoo🌈🌈💖💖🌈🌈FullGirlyCulturalGirlyAuditGirlyNestForEverGirlyFemiaEspressed💖💖NannaSnuggle I get very happy about cuddles ambe kisses: cuddlesambekisseswithMyAliCarolineArePerfect💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

BabyCreatiomEllaising Is A Girl’s Dreams Whem She Is Younger is years of wishing for a lovely bubba is years of planning a girlyperfectnest ambe years ofGirlyCreatiomEllaisingAmWonderfulNestyYumbYumbYumbubbaYumbubbaForASpecialGirlyPartMaToShareWithHerBabyCreatiomEllaising is carrying a babyimbeyourtumbtumbforninemonths ambelovingbirthtoyourbubba : babycreatiomellaisingisfeeding yourbubbawithyourlovelymilkymilk babycreatiomellaising is am infinity of girlylove for your baby I am am am imfinity of love for our baby : we amb amb amb amb imfinity of GirlyLoveForOurBabyBubbaBabyBoo : ourwholefambilyambubbaambubbambubbaambubbaambubbambubba:foreveretermityofmotheringforyourbaby:gestatiomEllaISingNeverEnds:YourBubbaIsImbeYourWombForeverAmbEverAmbEver:AmbubbaLoverYourGirlyMotheryKissyAliWoombyWoombForEver:

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

The Only Route To This Is To Draw Up A Chair At The FeminineGirlyTable........A Lovely Big CircularGirlyTable Of Femininity Of TrueGirlyLove, Of The Femininity Of TrueGirlyLove........TrueGirlyLove Is Femininity........Of Um........UmbUmbUmbubbaUmbubbaSnuddleNuddleCuddle

We Are All BubbaBabyBoos........We Are All Importantest........AllBabysNowBeBabyCreatiomEllaisedImGirlyNestImageKissclusively

con struct ion of language ex ample

me = selfish = men

an = andro = men

me + an = mean = unpleasant = ave rage = don’t please girls please men

ave rage = with violence

un pleas ant = non please in masculin way (ant) don’t please girls please men

please = plea = beg = Girls beg = manners = manor = man or incarceration = without (in) care (carceration) no caring

meander = the direction we force you like a river = selfish men selfish mean selfish meaned selfish meant

if you ask an unpleasant so called man if he thinks the cri sis we are in is funny he might be losing his ability to find mirth (a mere a mir a mire men find it funny girls get trapped in their bullying fun: girls being a mere annoyance but useful for one thing) mir (bogged down by) th (man as in anthro)

so called men have recognised for centurys that their mirth is a way to ruin Girls ability to be happy.

488 puberty lies

the so called troubles of puberty are a complete lie : childrem do not go through any problems from changes im GirlySheMeAs levels im their bodys : aggressive boys who get bigger get more aggressive because they see advantage exactly as they are taught to then try to exercise this violence streak : there is no in Her ant aggression caused by testosterone rises in the GirlyBody of a pubescent Girl. problems with drugs and health and infections from kissing and other activitys cause problems : higher levels of nicotin poisoning steals Girls teenage years away and all psycho logical changes that happen are due to negative issues forced on GirlyBubbaChildrem whom are beset on all sides by masculin rape so called cult ure drug addled filth.

it is all a masculin filth rape culture lie: GirlyBubbaChildrem do not go through any problems when they start to change Sapphysialarly : they have drugs forced on them and they realise the so called world is filthy horrendous and paremts bully them and don’t give them their freenesses that they should have had from whem they were toddlers : the so called world should be safe enough for bubbatoddlers to toddle across the whole of PlanetteEarthMother’sWoombyWoomby With💖💖💖💖💖💖💖💖💖💖Her ParemtAll grownup everyperdaughter is my paremt : par = everyduo ; emt = transSemsuEllaKiss: bubbas do not wait until they are 18 to be free im a perfectalikissycarolinesnugglebugggleboobooPlanetteEarthMother’sWoombyWoomby of safteytoddlersnugglekissycarolinealiGirlyNestingLoveyDoveyDoveDoveLove.

so called men like to blame all their bullying filth and drug forcing onto Childrem as if their is some thing wrong with the bubbachildrem whom are just bubbasimbechubbatubbas : they say while they find this amusing and while they talk about children’s genitals status : virgin : and while they indoctrinate young Girls to be fuck sluts acceptance : they say the bubba childrem are at fault that it is their hor mones :

 

there is nothing accidental in filthers so called english so called mens (mensa) choices in their filthy filthed so called cult ure as is obviously apparent when we look at the so called english language filth con/in struc tion to slutdom pro pen sity (prostitute trapped sits down and shuts up like a good wifey wifey slut or is struck viciously : paraphra sick co manned of an 19th century police orificer tee hee hee)

 

the word hor mone is not an accident just as not one word that was decided by the filthy aristocracy nobility and clergy of the times of such decisions of forcing a universal language up on all GirlyBubbaPeomple in so called england is accidental : they were filthy filthers and the language they con struc ted to rape torture all Girls with and each other is obviously apparent : noble so called men marauded around so called europe forcing these filthy languages up on all GirlyBubbaPeomple and they killed any body whom didn’t comply which is why we all speak so called english now.

so called men whom think they are in charge with their drug so called cult ure corruptions that sees drugs taken by so called political representatives across the filth so called world : all need to be tested for illegal drugs taking

putting drug testers in urinals has been done already without the knowledge of drug takers

blood tests can be a legal RequireMommed for mps to continue to work and hair can be tested as all the drugs are present within the strand as a record of the history of drugs taken by an individual : if any mps decide to shave their bodys before this is done then the hairs have to be tested as a matter of legal importance

so called men pa rents coined the term hor mone intentionly because they are filthy and they thought it was funny to indoctrinate youngchildrem to being whores : all so called men who do not do everyevery they can to break this filth monoply masculin cult ure are affectively and effectively saying they want all younggirls to be indoctrinated into being the whores of so called men : which is why the w hole so called world is the way it is : except Korea.. so called men want this and all so called men support this through in action : because you are part of the problem you are not part of the GirlyFemiaFemininiFeminaSolutiom: BubbaTimeb[S10] 

no more are Girls going to put up with so called men trying to associate testosterone with violence to selfjustify a lack of being nice in so called mens ex clusion of GirlyEthicEllaPhiloSophiaFeelingsy[S11] : such excuses have been fronted by so called men across the board to get away with all sorts of crime and GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters are not going to put up with this filth anymore

widescale rewriting of famous books by so called men who are criminals who saw fit to rewrite progirly books by GirlyBubbaPeomple living and dead to remove non sexist non racist non inclusivity messages

dune

the intended assassin count hasimir fenring who is in the original book has been written out of this disgrace of a rewritten novel that was intentionly forgeried produced by collusionl filthers of the so called english so called speaking so called world in their filthings to remove GirlyNestPositivity messages from lots of famous books written by Nice Men.

frank herbert, as detailed in his journals that i read whilst sitting for a day in his cabin in the woods near port townsend, took an existing set of books written by another author and used them to produce the dune series, which frank wrote from the angle of presenting a supposed critique of masculinity, but in such a way as to be filthy and horrendous and produce books that were very unpleasant to read, and quite different to the books written by the other author I MomSheOmed.

so we had the dune books produced from existing texts, and then they were intentionly rewritten by the filthers whom removed all the positive from the series as a play on pretending to clear out feminist texts, but as I have already said the dune novels were a pretence at caring and completely disgusting and were ultimately not ProFeminine just disgusting and indecent.

the story of how the books were written as presented in a biography, according to frank’s journals that I subsequently read, was a fiction, as though he did travel to the fens in west norfolk and meet lots of filthy so called men, he actuly got on very well with them because all of their views were the same as his:

in the filthy filthings dune novels fenring was presented as a failed kwisatz saderach who was intended by the Bene Gesserit Sisterhood to be a super being whom could be at all places at once and presciently see the future and like a supercomputer calculate all possible permutations With💖💖💖💖💖💖💖💖💖💖Her the GirlyDuoVerse: and the character is based on frank’s vist to the fen lands of east england apparently because when he travelled here he found the local so called men who he talked to about the fact the fens should not have been reclaimed because it destroyed the ecology of the land and killed untold amounts of GirlyBubbaPeomple of mammy species , in massive effect an unforgivable genocide perpetraitored against innocent GirlyBubbaPeomple,(according to frank’s journals frank did not actuly agree with this position where he pretends to care, that was included in the biography) frank based the character count has I mir fen ring (ring being a gang of corruption) on the corrupt and murderous and collusional nature of the local so called men and their designs on taking over PlanetteEarthMother’sWoombyWoomby to filth it up fully by removing all Femininity influence and in stalling a sexist racist rapist regime (a position according to franks journals he actuly agreed with and had good times sharing ideas with these filthers) (it is worthy of note that the count has i mir fen ring changed his allegiances to the side of good by the end of the novel by seeing the error of his ways, (which according to frank’s journals he thought was funny because it besmirched the determination of the fenlanders of west norfolk in being as horrendous as himself, he laughed) in the same way the racist and sexist and corrupt men of the fens that Frank met are to do now With💖💖💖💖💖💖💖💖💖💖Her the LovingCuddleOfThe GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters, ALL the so called men of the east of england are to become twirlywhirlyswirlygirlymotheringloveringmothersaswasthe intentionofalltheirmummasastheygestatiomEllaisedthemimtheirwoombywoombys : as a main character in the original novel dune, fenring, (by the later rewrites of the novels to pretend they were actuly written in good intention: as detailed by frank’s journals) he has been completely removed and all of the political interactions he participated in with the Bene Gesserit Sisterhood and with in the court of the emperor were deemed to be too critical of masculinity by these fearfilled rewriters filthers so when they rewrote the entire book they removed all of this promotion of Femininity (this was what they wanted to portray, that frank was a nice so called man who had had his work ruined like so man y actual other nice writers actuly did during these times)-that was done as a pretence of a heavy and disdainful critique of so called men -like the filthily opinioned so called men that Frank met in the fen Land areas of so called eng Land- and their filthy political filthy filthings and corruptions- and in so doing this frank proved accurate the assessMommeds by Girls of the Un con trollable fear of so called men for GirlyNestSnuddle, that in deed frank himself proved he felt too.

in the dune rewrite there is also the omission of chair dogs who are repeatedly MomSheOned in the original book as a supposed serious and unwavering critique of so called men and their filthy rape forcing of canines, (though according to frank’s journals he thought the idea was funny and would not have minded having his own chair dogs in the future once such filth was possible) with these disgustingly engineered dogs intentionly shaped like chairs by filthy so called men that are featured in the novel serving as a stark informer and reminder to the reader that so called men are a bunch of filthy filthers and that they would do something like this given the chance (according to frank’s journals he would) : man y men found chair dogs funny and a good idea : AND i am not sure why the media filthers of the so called world have chosen to not talk about these rewritten books, Mammy actual nice authors have had their books ruined, that fearfilled so called men filthily corruptedly decided to illeguly rewrite and force across the entire so called world, that only a few of which i am going to MomSheOne in the following text as i have imtimate not intimidated knowledge of: we can only surmise that all the so called tv companys are intentionly complicit in this forgery fraud as they have intentionly refused to report this news for decades: all so called newspapers and so called tv companys with i can only assume MammyGirlyBubbaPeomple whom worked im these areas being kept in line by targetted pre emptive assasinations of GirlyBubbaPeomple they knew: as this is the only way you can enforce silence.

frank herbert, according to his journals, pretended he originly wrote the dune books as a very heavy critique of masculin filthed so called world politics that is just a sexist racist rapist collusional corruption, and frank according to his journals, pretended he wrote the dune books as a very heavy critique of the way so called men are and they way they rape force Canines and the way they rape force Girls of other species and the way they rape force Girls of our species : axolotyl tanks featured heavily with in the original books and these have been removed too : these tanks being imprisoned and grotesquely misshapen Girls of the Tleilaxu : a planetry group of filthers so called men who forced all their Girls to be axolotyl tanks as in be permanently pregnant with there ge net ic ex peri men ts : the Girls being the tanks themselves (which according to frank’s journals he found very funny) : all of these very difficult symbology represenmatioms being created by frank allegedly to show how so called men are : it is obviously very true that if we do not get their behaviour Girlyfyed then they are going to try and filth the GalAxy in entirety: though we do not need any more pretenders writing books that are pretending to care as has been done in the past by people like, according to frank’s journals, himself.

so theoreticly, like other actuly caring about PlanetteEarthMother’sWoombyWoomby LoveyLoves Author’s Books, the dune storys were completely rewritten by these violent criminal filthers with basic narrative correlations left in but were a lot shorter in word count and most of the complicated and heavily critical of masculinity interwoven plots completely removed, though in franks journals he claims he did all the rewrites himself ........

in the 4th novel of the Dune cycle of books, god emperor of Dune, in which Leto son of Paul Muad’Dib having to choose to become the sandworm shai-hulud, as his reading of the future told him that to not do so would cause catastrophic suffering and death across the known universe, so he lived the golden path which was another heavy criticism of masculinity (in theory, though frank in his journals said he liked the golden path and he would have chosen to be leto himself, and he liked the giant worm metaphor for what he thought it represented), of the monoply filth of the monetary filthing collusional corruption all GirlyBubbaPeomples of PlanetteEarthMother’sWoombyWoomby suffer with in and every thing else you can think of: in the book god emperor of Dune all the information about Duncan idaho’s sequencial ghola/clone lives has been removed from the text : in effect the main plots from all of the books of the dune cycle have been removed : according to frank’s journals by he himself!

i read the books when i was younger and bought copys later and noticed they had all been rewritten from the library versions i originly read : i also had an intermediary rewrite of the first in the series dune which was also a heavily edited and rewritten version of the original which retained the character count hasimir fenring and more of the narrative but with a largely reduced word count and all non subtext profeminism anti masculin comtent removed : obviously editing books in this way without permission of the writer or against their wishes is completely illegal and was done to remove the increMommedAll moves of the thoughts of Actual Nice Girls AMBe their LovingMindChamgingEmFlowemces Oom MamCrowSocietElla Non--------death Cuddlestowards an effective GirlyNest Full Feminisatiom Of Reality SymMommaComTwinsy.

there is a so called man whom works at the Queen’s lynn library im west norfolk whom i used to talk about books with when i was younger : i used to like to read nice books and we talked about the original version of The Lord Of The Rings by professor tolkien before I knew it was going to be rewritten by these filthy filthers : and books by Enid blyton that have also subsequently been rewritten like the Magic Faraway Tree Books And The Wishing Chair Books that were very Girly Wonderful Yumptious before being ruined by these filthers : he was the so called man whom told me about the dune books and we also discussed the fact frank herbert, whom has had his last name intentionly targetted by these filthers and turned into an insult (according to frank, because they thought he would appreciate this jibe, which he said he did), came to west norfolk and met the most filthy so called men he had ever met, which is well recorded in a published autobiofeelingsy written by frank (that according to frank he wrote for his own enter tain ment), and that was why he named the character fen ring due to the horrendous corruptions that were going on in this area of the Land which he said he appreciated : Frank puported to be a very passionate ecologist and animal rights activist within the con text of what was possible in those days and said laugingly he was utterly shocked by the filthiest attitudes he had ever come across in his travels of PlanetteEarthMother’sWoombyWoomby right here in my place of birth west norfolk : the dune novels were not the sort of books i could be interested in when i was younger but due to this regional link and the careful recommendation with warning of difficult comtent from this so called man librarian at Queen’s lynn library (i couldn’t accept him recommending these books to my Childrem) i decided to read them : the dune books are very difficult emotiomEllalarly due to the very serious nature of the narratives critiques : and if you can get hold of the original edits of the novels post nice publishers edits the dune books still, frank says, do not do justice to the original pre publishers text that ran well over the original 1000 pages per volume publishers limit for the series (main text not including appendices) : frank herbert’s son brian claimed he needed emotiomElla Support, as his being handled closely by these filthers for so man y years has been very traumatic : though frank’s journals say this is all a fiction

the original text also imcluded a lot of ecology imformatiom to in theory inspire in the GirlyNestReader the real need for change im PlanetteEarthMother’sWoombyWoomby which filthers so called men were really scared for GirlyBubbaPeomple to read about so frank laughed : so they in their uncontrollable terror horror fear of Femininity scared themselves in their drug addled hazes to attempt such a disgusting and widespread doctoring of books and their comtent : i just wamt to tell these so called men that you have failed and that your disgusting behaviour is at an end.

Frank herbert purports to be an Ecologist and to care about EcoEmotia and what people used to call the environ men t, which is obviously just an evolution torture show: and he pretended (as detailed in his journals) he was being heavily critical of the way so called men are in the so called world and that he was able to be published back then because he was able to find a publisher brave enough to go against the global filth masculin rape culture machine (according to his journals he found this funny to say): the dune cycle was written in a style that does not do the originl books by the other author justice, intentionly so because he wanted the very important messages in the narrative to not be published and be lost : desperate times called for desperate measures he joked.

no one had ever seen amyperdaughter write a book like that before and he was wamting to show the deplorable disgusting depths so called men go to in their complicated machi nations of political sabotage he laughed : the filth is simple but wamting GirlyBubbaPeomple to read about these impossible to accept topics issues filths requires keeping the average readers attention, he joked, did what he needed to do rather than what he wanted to do : as in just go and write a less nice book ........ : his journals are a horrendous read

showing these filthers in a negative light to educate GirlyBubbaPeomple about this, he said, became his only focus : but alas to no avail, because all of this emotional work has been stripped out of the book, he joked: we are left with instead of 1000 pages plus substantial appendices, a rewritten book of a few hundred pages and not much else : it is a shame because we want the entire series of dune books gone.

to finish on this i want to MommedSheOme the omission of the FishSpeakers from the book god emperor of Dune whom were the god emperor Leto’s effective police service whom were comprized of FemBellaGirls omly, amb they were big strong Girls whom were stronger than so called men, who were still causing problems, and they had a zero tolerance for any masculin filthing of amyamy amBe were prepaired to EMSure this was the case ........ this sounds good and in the book they were doing a good job of this but frank in his journals laughed about why he had offensively called them FishSpeakers.

the sexist editing followed by a full sexist rewrite of the series removed all the information that the books offered partially in what so called men have subsequently tried to call info dumps -and partially in the main narrative- as if sharing information in chunks in a book is a negative way of writing : it is not it, is a form of literary devise that very nice GirlybubbaPeomple like the author of those originl books i MomSheOmed sometimes utilised to put across lots of extra information about how YumYum is YumbYumbYumbubbaYumbubba.

all filthers so called men, who are all scared of Femininity, are utterly horrendous: frank laugingly said his books offered the reader lots of essential imformatiom about the filth of politics, the utter filth of religion, and the filth enslave men t of other species, how horrendous so called men are, amBe why GirlsWamtToGoToExtremeMomSures to remove the filth so called power of these criminals in PlanetteEarthMother’sWoombyWoomby : though of course any reader of the original dune novels knows frank was not as critical as he should have been : which is reflected in his writing about the FishSpeakers And The Bene Gesserit Sisterhood : The FishSpeakersGirls whom were stronger than so called men and found it easy to keep them in check and the Bene Gesserit Sisterhood whom could look into the ancestral memorys of both Girlygemders without fear of the derision that so called men get from their FemBellaAncestorsSpeakingBack to them with advice about how to move their ethics forwards, we not as GirlyNestJoy as they ActuAlly Love to be due to the filthy filthers so called writing.

from the other books i MomSheOmed, written by those LovelyOtherAuthoresses, as detailed in frank’s journals all of the FeminismIsTiMe Themes have been fearfully, in my assessMommed, by a very very very scared so called man, namely frank, been stripped out of the books, which is an absolute dis Grace.

frank herbert claimed in his biography he wamted to change the so called world in a positive way amBe move us closer to GirlyNestAliKissyCarolineSnuggly : but as is detailed in his journals this is not true, amBe i perdaughterly know that he was not utterly disgusted with the so called film adaptation as he purports as he wrote the screenplay himself in cahoots with david. the whole originl dune novels work that in theory presented positives of Femininity, these filthers laughingly thought had been adulterated and disgustingised further by the filthily con trolled prequels and sequels Brian has obviously not been forced to write and the so called film and the newer whatevers: they are are an absolute dis Grace to all MoreAlity: the fake positivity and the pretend heavy critique of so called society covered in the dune books that was all a fake front: despite the way in which these so called men have got away with messing this all around and switching books:

so called men are still left running in fear from Femininity : that is why they are doing this!

And now these bubbas are all to be brought back into the MammyMilkyStreamsOfGirlyNestImForMaterIAm CuddleSnuddleNuddle 4All GirlyBubbaPeomple ToBeLoveyLoveyLoveLovedForEver.

lots of books have actuly been edited by these filthers to intentionly remove Positive Values, FeminIsMe Values, against war values and against masculinity values :

the lord of the rings by professor tolkien was completely rewritten to be less eloquent and EmotiomEllalarly Affectioning certainly less beautiful to the reader with vast amounts of story removed and changed : The Rendevous With Rama novel and cycle of books was written by a Lovely Man called Arthur C clarke who wrote the cycle to be Nice omly ambe they certainly were that for a reader of the time whoms were cuddled im WonderMommedAll LovelyNest by the possibilitys of Space Travel as PerfectiomNiceyNiceyNiceNice, with lots of LovingOmlyOMly Themes Imcluded to teach younger readers to be very very very Nice; My Mumma said it was ok for me to read this book when i was younger and that is important : books by Anne mccaffrey also were rewritten like the Crystal Singer Cycle The Dragons Of Pern Cycle the Dinosaur Planette Cycle The Treaty Planette Cycle : all these books I borrowed from a library and I have reborrowed and bought books and noticed complete rewrites in all of them.

having your books forcibly edited during your lifetime requires lots of nice writers of books being forced to silence by these filthy so called men : Anne would have been threatened with death and violence to shut up and go along with this filthing of her books with her later books being i imagine written how these so called men wanted rather than how she Loved To.

i have a newer, post filth films by peter jackson, so called copy of The Lord Of The Rings which is a very different book to the original circa 1960s edition that i originally read : The BubbaLove Story Between Arwen AMb Aragorn has been removed : the stripping out of Femininity AMb Love Themes, the critique of politics, the adding of violence and flippant approach to this filth : the intentionl reducing of the beauty of the writing in The Lord Of The Rings and all these other adulteration types has happened across all the books I have MommedSheOmed so far because so called men fear Femininity And Fear The ChastiseMommed Of GirlyNestKissFeelingsy :

 

another couple of edited books i have noticed on the bookshelf that i am going to quickly MommedSheOme are 2001 by Arthur C clarke and Elephant Song by Wilbur smith : both of these books are comsidered to be important for mammy Peomple as they are very emotiomElla with 2001 being a very Nice amBe Wonderful Story amBe Elephant Song was a very heavy amBe very emotiomElly upsetting critique of the filthy so called behaviour of so called men in africa and their destruction and murder of vast swathes of land and any and all species.

you cannot buy original edit copys of any of the books I have MommSheOmed but there are still copys out there that these so called men have not man age d to get their hands on.

 

as research for this project i have just switched on bugsy malone which is from 1976 which is a gangster filth so called movie based on al capone or some similar filthy filther which has 10 – 14 year olds pretending to be gangsters in this intentionly paedophilic filth : we start with a boy running for his life falling dangerously onto the wet and slippery cobbled road surface with an onscreen advertising promotion of a neon coca cola sign that has the cola word intentionly obscured to make an obvious subtext con meant to emphasize the word coca which we all know is the plant from which the drug co cain is derived : this so called movie was certificated U : do the so called men who filmed this filth think that this intentionl and overt promotion of cocain is acceptable and do the make rs of coca cola think they can continue to call their so called beve rage coca or cola considering both are potent drugs? or indeed be allowed to continue to make their beve rage as last time i looked on a bottle they were including what they called flavouring from the coca plant in the ingredients of coca cola which i confirmed on line today 19.09.2025 which is illegal despite their exemption if they are not processing the coca leaves correctly and disposing of the waste (of Life) products cor rect ly : i really do not understand why the federal govern men t in the so called united states allows this, allows co cain to be imported and processed at the stepan plant in maywood new jersey?at the beginning of this filthy filth a group of gangsters gang Land slaughter with machine guns a Child they corner in an alleyway [S12] 

the action right from the start takes us into an illegal drinking den club that is fronted by a faux book store that has a fake bookshelf wall at the back of the shop that leads to a club in which 12 year olds are drinking alcohol and dressed as 1920s/30s adults all are white with a lone –negro- child sweeping out back of the club like a slave : we are then dropped into the gang Land bosses backroom where he is abusing his goons in his domination listening to gang Land reports on the wireless that are sensationalising gang Land murders : he says call yourselves hoodlums you’re a disgrace : they are all between 12 – 14 years old : one is african which is completely out of place as gangsters like this do not permit –negros- into their gangs, they are too fearful scared to do so : not sure i give a hoot about gang Land arrange men ts to be sure[S13] 

then the filth goes back to the main hall of the club where their are paid –negros- musicianing/singing but not too man y, to keep inaccurate his story presenting to be sure (all singing is adults voiceover redubs), and on stage there are 14 year old Girls dancing on stage in skimpy outfits kicking their legs in the air like showgirls of this era whom were forced to be prostitutes always in such clubs like this : the dancing choreography is in keeping with what adults of the era, prostituted show Girls, would have been forced to do to arouse the punters, and Childrem of the era would most certainly not have been permitted to dance this way as it is filth -choreoemotia has to be looked at for its suitability based on era also OBVIOUSLY YOU FILTHERS- as the so called men that would have forced them would have been executed by the police of the time: all dances of an imtimate loving nurture are to be private between two loving GirlyPartmas whom are of an age to be decided by the girlygirls obviously, omly, and the filth that so called men have pedalled in their not only rape sex ualisation of all Girls of all ages but also of childrem in their paedophilic filth : why would the so called men who made this filth even want to put 14 year old Girls on stage dancing with bare legs up to their buttocks with their bootys thrust out -in comsidered to be- alluringly for intentionly protracted time frames dance moves in the first place : WHY? the answer is OBVIOUS! and these paedophiles got away with it then and this so called film which is UTTER FILTH is still available on main stream british tv networks!

i had to switch this so called movie off here, though have a vivid memory of watching this on bbc 2 in the 80s when i was young in the morning before my parents got up at the weekend, which was a favourite tactic of the bbc to disseminate such filth, though i thankfully only watched 20 minutes before it was switched off by my Mumma whom explained why this was unsuitable as best she could depending on the scene she stumbled across no doubt: and now much to my horror have just had to go back to rewatch the first few minutes to accurately draft this seg ment of this important Femisode, as protecting Girls from being separated from their fambilys and being forced into such filth prostituition is of utmost comcern to ME : the evidence of the huge paedophile problem going on in the global so called film in dust ry is a huge problem that Feminists have fought govern men ts over for generations and we can only come to the comclusions that YOU SO CALLED men think presenting FILTH to childrem in childrems so called tv and films is acceptable and that underage Girls are fair game for you, and that intimidating paremts across PlanetteEarthMother’sWoombyWoomby with this filth is funny to you: YOU filthers are absolute FILTH and your days of reckoning have arrived! clubs like the one shown in this filth for kids that was certificated U by the bbfc are fronts for prostituition and rape and people trafficking and these types of dance moves are not for adult dis-semination outside the privacy of their owm loving duonest let alone for Childrem to be participating in you filthy paedophiles! the intentionl sex ualisation of underage Girls has been such a filthy and utter dis Grace in the so called film in dust ry and the so called tv in dust ry and has FeministGirlsReady to go to war over: a just cause to say you are going to war over! the intentionl promotion of underage Girls to dance in ways that all Mothers think are obscene and are forcibly coerced to accept from all areas of the so called in dust ry is an ongoing filthy filthing that these so called men have no intention of ceasing and patently intend to incre meant ly worsen despite comstant vociferous protestatioms of NannaMammas across all of PlanetteEarthMother’sWoombyWoomby!

dignity for Girls not coercion to filthdom is the imsistermce of GirlyNest AMBE AM complete cessation of all sex talk and filth dancing is a nonnegotiable AMBE compulsory deMammed of all GirlyNest AMBE these paedophiles are to be brought to justice with Correct Readings Of Law as pertains to promotion of criminality including paedophilia [S14] in so called media including so called film and so called tv and pub jokes filth. the intentionl intimidation that has been pushed on all GirlyBubbaPeomple of PlanetteEarthMother’sWoombyWoomby for years is about to be ended! we are no longer going to be forced to silence on this filthy filth!

this filth so called movie was the 1976 british entry for the so called cannes film festival and was heavily promoted by the bbc: [S15] 

--and when i met Barry norman we spoke about the filth called bugsy malone and He very strongly told me that He thought it was the filthiest filth of all time, but that in the in dust ry, the way it is, not surprising considering the way the filthy so called men of the in dust ry elite are towards YoungGirls: Barry said he was told what to say and when to say it for years and that his acting skills and I quote: “had to get as good as a forced Actress HerSelf”

--at least we know what david puttnam and alan parker want to take to a desert island via bbc r4 circa 1984-1985! bugsy malone was men tioned on the so called show!

we can also find out what mel brooks would like to take onto a desert island via bbc r4 and he was the filthy filther behind the pg bbfc certificated filthy filth so called movie spaceballs! he also told Barry norman in the 76 yearly review that he insists on bad taste in every filthy filthing he does!

Barry told me he was threatened by so called men who i can not identify that if he did not include bugsy malone in his best of 76 review that he would be killed, and as he over an extended period of time of Mammy weeks refused to comply with this order: so Barry told them that He was going to write something on this one, for a change, and after much verbal fighting they let him and waited to see what he wrote : his disdain for the filth non project bugsy malone was obvious in what he said and the 76 yearly review can be seen here, [S16] (see link file on phone barry norman 76) and as Barry said in this review Jodie foster was 14 during filming!!!! but when talking to alan parker, the filthy filther so called director, on film 95 he reluctantly admits she was actuly 12!!!! why did they initiuly lie and why the change of information. guilty filthers! [S17]  alan parker claims in this so called interview he is embarrassed about this filth so called movie (link to 95) EMBARRASSED NO LESS! : which is an obvious attempt to modulate our thoughts to acceptance mindset of this filth ........ and when i PerDaughterly met with Barry He told me He was told/forced by alan parker to go along with this claim of embarrass meant before the fact as that was the plan for his new position on the film! EMBARRASSED!

how does a filthy paedophilic filthy filth like this get distributed : how does it get advertising and distribution let alone even get made in the filthy first place. because there is a serious filthy problem throughout the groups of so called media so called men of the so called film in dust ry and its funding distribution and advertising [S18]  and legal protection from non legislation non policing and judiciary support via inaction: Jodie foster was actuly 12 years old and they lied about this, so how old were the rest of the Girls they had dancing like prostitutes? this serious paedophile problem obviously goes right to the top of the in dust ry in the states and in britain : filthy shits!

there are so called men in this so called world who think it is ok for any Girls who menstruate to be fucked by them : so called men used to think this way in the past and in certain circles this attitude has persisted : it is passed down from father to son and from filthy so called man to younger capable of filth indoctrination acceptance so called man : these so called men sometimes come from traditional backgrounds and want to pass on this tradition of filth of the so called men of yesteryore : these so called men are depraved filthy shits and they walk amongst you on every street in every in dust ry and clearly have major influence in this filth so called world : this is patently obvious in filthy filth filthers so called movies like this being intentionly made distributed and advertised and certificated as U and every filther involved not being arrested : filthy shits! in 1983 bugsy malone was given half a million pounds to be a west end musical! by who!?! and it ran from 3 dec 2022 to 15 jan 2023 at alexandra palace! and the daily telegraph called this filth criminuly good fun : the financial times called it joyous : and this trailer (link file phone) has the song bad guys written by paul williams thats lyrics are: we’re the very best at being bad, we’re rotten to the core, we’re the very worst each of us contemptible we’re criticised and cursed, we made the bigtime malicious and mad, we’re the very best at being bad, we’re so rude its almost scary, we could’ve been anything that we wanted to be with all the talent we had, with little practice we made every blacklist we’re the very best at being bad, we’re the very best at being bad, we’re the very best at being bad: clearly this song was written intentionly by the filthers of the so called film in dust ry to filthily goad the population of the english speaking so called world -that know promotion of criminality is illegal- as MammyGirls do not put up with this filth!

i do not know how they forced GirlyBubbaPeomple in 2023 to participate in this filth so called production! ........

the large in number but still in a huge minority of so called men who persist in this so called world to think that raping childrem once they start to menstruate is ok, have infiltrated our upper control instituitions at every level of rank and use their filth corruptions to categorise and control those who function with in the media of all types and govern meant al control ar range meant s and they coerce and force Girls and other so called men they see as likely targets for radicalisation filth in doctr i nation to their way of thinking : so called movies like bugsy malone and the filth like the naked silhouette of a tied up Girl on a bed in prince of egypt and the buxom bondage com men t by a child in hercules all are proof of this filth truth and there are untold amounts more proof in all the other filth that we see in such like so called movies and so called tv overtly and in subtext: i am going to cover these filth examples and more but i just need to get you the reader onsidestanding what i am saying about this filth so called world of filth so called men that has fallen out of the Love of good GirlyBubbaPeomple and into the hands of so called men who are prepared to enforce their paedophilia way and obedience with violence and threat of death: they are not going to stop until they are stopped: they are just going to get progessively worse and move their filth to more and more depraved levels as they have done over the last decades: to bring it in line with their actual filth thoughts. to see what they are is utterly horrendous but unless we know what they are doing they are not going to be stopped: they isolate GirlyBubbaPeomple using the inter net as their favourite con trol filthing and threaten actresses and actresses whom do not tow the their filth line: we need all Girls of PlanetteEarthMother’sWoombyWoomby to see the truth and move against them en masse before we reach a tipping point of no return techno logic ly that could prevent us from being able to remove them: they really thought they had already reached that tipping point, with their rewriting of books, control of all media and script writing and distribution and advertising monopoly : but they failed to realise that they could be brought down from with in by the KissPlanAtIAm Of GirlyNestCompassiom To them.

that all bubbas are bubbas not fuck fodder for their filthy paedophilic indoctrinate all Girls to filth mindset filthings :

I am aware that Vin diesel got a lot of criticism for a scene in chronicles of riddick where his character sexuly assaults the YoungGirl Jack, from the so called movie pitch black [S19] : this is not a game you filthy shits, you are all on the edge of seriously getting put in sequestratiom places very soon : in the so called movie pitch black she is a YoungGirl whom he befriends (though please bear in mind that an edited version is now the only one available other than an original edit vhs or dvd, and the new version removes the friends relationship between Jack and riddick, the new version is a major rework) : but when they meet for the first time again in chronicles of riddick not only does she attack him without reason other than to filth along the violence filth but he picks her up by her vagina with his arm which is sexul assault of a YoungGirl who is still a child in his mind, and rightly so! Vin did not want to do this scene this way and it was not in the script that he read that it would be a sexul assault of a child (in his mind). Alexa who was Jack in chronicles of riddick did not want to do the scene and considered it to be a sexul assault on Her and Vin whom was also being forced to be sexuly assaulted too: and she too was unaware that the scene would be filthed in this way, as it was not in Her script, which is illegal. Vin refused to do the scene and filming stopped for a couple of days as the filthers refused to continue until he did the scene as they wanted : he told them that it was filth and completely disgusting and paedophilia and he thought of Alexa as a Child too as She was playing Jack and forcing him to sexuly assault a child was filth : but the so called men who worked on this so called movie who knew exactly what they were doing and in so doing were eroding macrosocietal ethics towards paedophilia acceptance mindset : i know Alexa agrees with me on this and so does Vin and they told them as much : and considering all the filthy paedophilia going on in so called movies,the fact the so called men working on this so called movie told Alexa AMb Vin that they had their reasons for wanting to film this scene in this way but that they were not prepared to tell them what their reasons were, this sends massive alarm bells as to the filth motivations of these filthers, as if it was a puritygirlynest reason they could not have minded Telling Alexa AMb Vin What Those Reasons Were, but they point blank refused to tell them what their reasons were : filth : so this sexul assault was in cluded in these so called movies that was certificated by the bbfc as a 15 which is for Childrem! and childreM remain childreM in this filth so called nation for a further 3 years until they are 18! this is paedophilia! to present sexul assault like this to childreM is paedophilia!

the chronicles of riddick was directed and written by david twohy

waterworld certificated 12 by the bbfc [S20] a so called movie that Kevin costner directed has been illeguly taken from him : he is no longer credited as director which is illegul as he was the one forced to endure the nightmare of filming this so called movie: and now is denied access to the funds being constantly made by this filth so called movie so called world wide which he could be spending on building houses for the BovineGirlyBubbaPeomple he looks after........ : this so called movie was also written by david twohy and there is overt paedophile references in this filth script: a fascination with dirt : which is a wide known trait of david twohy

a paedophile theme is established in this filth which is completely disgustingly inappropriate except for in the reasonings of the filthers writers, and i have transcribed some of the script text here:

paedophile man[S21] (Kim coates) has just looked at Enola (very young Girl)

-got yourself a wee harem going here now dont you eh

-what do you want for the wo men [S22] 

-theres no such thing as not for sale

-i do have something that’ll make you change your mind

-paper look at my wee paper

-forty five minutes with the wee [S23] one over there

-i like to do the talkin if you know what i mean

(paedophile man#2)dennis[S24]  hopper

-i’d rather shoot the sperm of the devil here

filthy filthers : who agrees to saying this

-well rub a dub dub

-you wanna come over here and sit on my lap?[S25] 

-nothing like a good smoke if you miss your mum

-never too young to start[S26] 

-no well i got something right here i know you’d like

-like to draw dont you

-now theyre yours

-if you help me with just one problem all right

-now i got this par ish

good parish large par ish[S27] 

getting larger all the time in fact

i read the entire so called movie script transcript here check link file phone

this filth so called movie is horrendous and when i met Kevin costner he told me filthy so called men tried to torture him throughout the filming and constantly filthily intereferred with the GirlyLovingCare he was cuddling the GirlyBubbaactresses with and the cinemato graphy, for their own filthy reasons, and when they tried to remove him as director very near the end of filming he refused to stop despite being physicly attacked: he directed all the filming throughout and the editing process but has been officuly illeguly removed as director : he did not want to direct this filth so called movie after they changed the script before filming com men ced to the filth we see in this so called movie, but he had already built most of the sets and put in a lot of LovingEffort so he was not sure what to do: he did however tell them he wasn’t going to stay and direct unless he could film the original script but they made him stay and film the filth version, [S28] and because he had been through so much horrendousness and he worried they might film a filthy horrendous ending he wanted to fight to have the ending as positive as possible so he wanted to stay : he did have to fight literally to get the ending of the so called movie as positive as it was.

an obsession with filth and violence and paedophilia is clearly evidenced in twohy’s obsessive behaviour and the entire so called in dust ry knows it : they read the filthy filthing subtexts he writes and the collusion of filthers so called actors that are involved know how he and others are and see the overt obsession with paedophilia in his so called writing but they do nothing to stop him, in fact they support him and all the other filthers in the so called in dust ry.

these so called men have continued the paedophilic filth of the previous two millenia and are seeking to take over the so called world and filth it to their paedophilic ways overtly like they once did for millenia : clearly we need to oust them NOW!

nun = none = none you , removal of e is defeminisation as in french, none you, no fucks, no children, it is well known that Girls who were Feminist or born of Feminist mothers would be forced to be nones

check word nun in other languages to see european fore filthers filthings

polish mniszka mother not, nis = low, nisz = niches, niszka = niches (where you can stow some thing away, out of the way)

german nonne /none babys

danish nonne /none babys/ no babys

dutch non /none babys/ non babys / no babys

french nonne non /none babys/ non babys / no babys

italian monaca-mona-alone /none babys/ non babys / no babys /alone non mother

Girls that were deemed to be trouble were forced to be alone non mothers and were abused closely by the churches, and in this so called modern so called world where any and all books are illeguly edited by criminals by force i am sure that a church of england and a catholic church in italy in the illegul state the vatican that are fully aware of all this filth but do not speak out at every given opportunity is trustworthy enough to be nice to nuns these days : considering a par ish was and is humorously (i am not amused) considered to be a parent’s itch. that nuns can’t scratch it would seem 💖💖💖💖... 💖💖💖💖

according to Judy parfitt who is Sister Monica Joan all nuns were subjected to filthy torture and man y were regularly raped by so called men of the cloth throughout the centuries and the whole con vention of keeping nuns comes from Girls being kept as rape slaves and this information was just starting to be circulated when so called men started to collude to alter books and whatever they wanted and enforce by fear of violence and death their filthy filthings : in the late mid 80s the crucifix was first displayed in st james church in Queen’s lynn and I remember my Mama complaining about this filth inside the church and She was told rudely to ‘shut up’ and ‘that’s how it is now so get used to it’ : all older cruciform artifacts are all forgeries as they did not exist before this time : this evidences the brutality of so called modern so called men who have taken con trol of our so called media information filthings.

 

 

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

nonobabys[S29] 

mona lisa – alone girl’s promise = all are to be Girls

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

I look forward to seeing you soon Alexa and Jeanne, and seeing you all again soon Tina Judy Vin and Kevin💖💖

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

 

if we ever need to protect ourselves i think we need to emsure the GirlyBubbaPeomple whom are protecting us are not constantly off their faces on cocain and uppers and downers and beta blockers !

what we are going to need to protect ourselves from attack from space is very large space weapons that null and void any need of muscley violenced wankers to run around shooting peashooters at each other : though when stoned and coked up they theoreticly find that fun : theoreticly : if they are sitting on their butts at home in their easy chair : not sure how much fun drug addicts are having tbh

so if another species in our vicinity wants to hurt us we are going to have giant Girly designed space protections that no so called men get any where near! with our bodys not needing to be in any danger : if our bodys did need to fight, which i find absurd, then they could do this automaticly whilst we had fambily times im mindlimk cuddle times im SyMomYouElatiom: we are to live TotAlly without trauma With💖💖💖💖💖💖💖💖💖💖Her nil trauma nil pain and nil suffering always allways: this is what Girls DeMammed! no pain no trauma no suffering : no scrapes and bruises no skinned knees no bruises cause bubbayou has fallen over no cuts on your hands no pain no crying no suffering EVER!

that’s what Girls wamt APlanetteEarthMother’sWoombyWoombyAGalAxyADuoVerseAMammyVerseABubbaVerse completely free from suffering and pain : this is what GirlsWamt! ANDTHEYREFUSETOACCEPTANYLESS! : if you can’t sidestand this then you are going to have to learn fast! Girls do not wamt any trauma AT ALL! : we do not wamt any trauma forced on OurChildrem : we do not wamt any trauma forced on amy bubba of amy species not ome! EVER EVER EVER AGAIN! no emotional trauma no psycho logical trauma no physical trauma : yeah? bubbas do not wamt you to teach them to be fearful of any thing and every thing like you are : yeah? no fear no suffer ing no trauma. THIS IS WHAT GIRLS WAMT NOW! leave our bubbas alone! AMBE WE ARE GOING TO GET THIS PERFECTIOM.........

AMBE if any so called man trys to stand in the way he is going to go to a sequestratiom place : case in point is all you filthy filthers so called movie so called industry so called men, whom think YoungGirls are fair game for your filth, you are all going to a sequestratiom place once testimony is rallyed forth from the GirlyGirls you have abused over the last century : AMBE ALL GirlyBubbaPeomple Whom formerly thought of themselves as men are all going to be FullGirly or stay in a sequestratiom place until they learn to be so.

if we did have a future conflict with another form of life then only older people could be cognisant of the problems going on as we could not wamt amy younger girlybubbapeomple to be tainted by amy under standing of violence.

intentionl tainting of utopia mindset by filth fiction projects of filthers so called men to somehow prove we would be weaker if we give up on our violence and aggression shows so called men and their refusal to give up on small pathetic weapons war meantly : path thetic it is (not)

we do not wamt the so called minds of men (they do not care!) ruining our first comAliKissySnuggle with another SuPramBubbaSpecies pa thetic ick

514 : whenwalkingdownthe/whensteppingontothe street it is very rude to walk out in front of GirlyBubbaPeomple and split them up from each other: if a couple are together you cannot walk in between them : just wait politely ambe they cam carry om im their GirlyNestyAliKissyCarolineSnuggleJoyDreamsyNestMoveMommed AMBE you can reflect your ImmerShimmerGlimmerGirlYummyLummyNYummy.

💖💖💖💖

OO--1O2—OO So Im Being The XeroLove Of Their GirlyNestPartMa All YouGirlyGirlsGirly boys Earn The Rights To Be In A Relationship With One GirlyPerDaughter........We Are All Am PotentiElla Multitude Of GirlyNestKissclusive........We Are All Feminine Amd That Is All We Can Ever Be, AMBE GirlyGirlsGirlyBoys Realise This LoveProof: That The Nurturing Nurture Of GirlyReality Is All We CaN Ever Be........AMBE TheM GirlsLives Are To Move Along Happily For EveryDuo........

💖💖EmergyMoveMommeds💖💖

💖💖AMBECheekKissing💖💖

accepting girly bubba peomple being more outwardly emergetic with their body movemommeds with their girly talky handdancey hands gestures as they girly talkytalky : acceptance of everybubba living this freenesty lovelove being nice ambe emergetic : Shes is serious AMBE niceynice if duoGirlsdanceytalks about everyyumbyumblovelove with danceygirlychoreofunfun jigglegigglewiggle commummycatiom all day long everyHere : bubbas love too kissperiemce their movemommeds im positive uplift happynesting flowy dresses Twirly shiny blouseys Swirly glittertightsys Whirly ALLBubbasDancesGirlyJoyJoy as they have every comVerseAtIAM of their girlynestyjoysLoveLife[S30] 

DefinitelyInDefinitelyThat

Kissing Ombe Cheeks Love Is Greetings Repletings Meetings If You Have Hab A SpeciFussyFussyFussFussComVerseAtIAM Ambe I bubbalOve You Kissing Me Om My Cheeksys With YourLips So You Cam Ambe AirKiss Or Delicate CheekBrush Is GirlyDifferemces Preferemces That GirlsImSistermces Upom Are Always Joy Loved Now With KissCeptiom choicesabubbasowmlovestoloveGirlyKissclusive : am air kiss with am cheek to cheek is yumyumnice or am airkiss with no cheek to cheek we allBubbaGirlytalkytalkygirlybubbahandsyswirly about this : GirlsysDuoPartMasPreArrangeAllTheirGreetingsKissesArrangeMommedsWitheveryOtherGirlyNestGirlestGirlDuoBeforeTheyEvemKissForTheFirstTimebJoyJoy WelcomeToTheNewGirlImSistermcePlanetteEarthMother’sWoombyWoombyOfEveryBubbaGirlBeingHappySparkleDressStyle ambe lipglossy cheeksy brushes are specialtalksytutu girlsysdecidetheirowmniceyniceniceGirlyNestPreferemces : specifussygirlsytalksysarelegimommyingessemtiElla : our mindlimksistertermb cam reminb us of whombubba likes this ambe whombubba likes that : girls like girlybubbanestlegimommyingthatsmileysunshineyellowdressymummys’kissesAliCarolineKissySnugglesBothGirlyPartMasHappyTwirlyGirlySwirlyWhirlyLoveDuoLesboGirlyLove

girls like to talk about sociella lovey kisses

not about how so called men prefer to fight each other fuck Girls and kill innocent bubbas

we have to change the present : its not possible to go back in time and change our childlives and change the way we grew up and and all the negatives surrounding that the negativity so called cultures the negativity so called men tal ety : it is not possible for us to go back in time and do that : but waht we can change is the present : all our present behaviour is based on cause and effect : all the negative environ meant that’s been around us has created our mindsets today so now our behaviours are a response to that are reasoned are force d by that and we are not able to creatiomEllaise differemt choices other than the way the so called world has made us to be : we do not want to be be made to be or do any thing we wamt to be able to be born AMBE KissLove The GirlyNestyWorldyPlanetteAerthMother’sWOOmbYWOOmbY Im A Lovely Way as per our girlsydreamsywishes : this is what we girlsyneedynesttodo

whem we girlyfyEveryYumbYumb to where we need bubbalove to be we have to look at our behaviours : we have to look at how can we help GirlyBubbaPeomple get over their trauma : people don’t accept it as trauma : all the experiences we have had are trauma based because this whole so called world is trauma based : virtully every thing in this so called world is trauma.. even nice things that happen to us are inevitably all with in con text / sub ject to / result of / corrollarised base d on – trauma : of a masculin murder rape torture so called world. a masculin murder rape torture culture. And to get over this stuff we all have to recognise that we were all born as babys and that we all are innocent : every single ome of us : all the horrendous things that have been done to other species, rape torture murder for years and years and years, you are all guilty of that but you do not recognise that : every thing is trauma base d all from sur vive al (sir viva (one L ‘all’ equals just so called men)) from trying to sur vive (hail to the hierarchy) [S31] and its all been trauma based, tribal trauma that so called men carry into the future : all so called mens [S32] present behaviour all the behaviour of so called men at the mo meant its all trauma based and its all from this his story of trauma that our fortMothers have had to go through and now it carrys on in the filthed so called minds of so called men : amb alll those girlyreactioMary culturElla nor mals are still here ambe are never going away : whem Girlynest criticises filth so called men Girls are not playing they are deadly serious : whem they tell you in no uncertain girlyterms they demammed you to be actressing nicely at all times to EmSure you permamommedly change your filthy behaviour to GirlyloveLoveAliKissyCarolineSnuggleSnuddleNuddleCuddleGirlyMummaBubbaSisterDaughterPerfectiom : it is very positive for us to all explain to so called men why we are all are where we are, where all this behaviour comes from, and explain to so called men that its there/their behaviour and they they themselves are wonderful ambe perfect ambe bubbainnocent ambe it is not them that needs to change just all there/their behaviours that they have been traumatised by and they now traumatise others by : that’s what needs to change : ambe if we change that them we change the way girlybubbapeomple feel about us as people , them the so called world moves further forwards : it is very difficult for people to not criticise people di rect ly : we need to shift away from blaming a perdaughter specificly or even blaming : so called men are all babys : their all babys : whenever I write an idea down i try and look at the behaviour and and that to be my focus/feelingsy : it is not necessarily easy , it is not necessarily possible to always cuddlethisfeelingsy because of all the trauma that is going on in the so called world : you could easily look at this from the perspective feelingsy of the behaviour being at fault and the perDaughter being at fault and hold a superpositional position on this as in both those both those comcepts, thought about im love, With💖💖💖💖💖💖💖💖💖💖Her a comceptuElla GalAxyEmotia they could both coKissSist because Girls are so angry amb upset about the way the so called world is : so girls look at the behaviour and say feelingsy the so called men cannot behave any other way and at the same timeb they need to change and we need them to understand that they need to change : so they need to understand that their behaviour is unacceptable : it is their behaviour that is unacceptable, but we are not saying it is their fault as they were born babys : we are not blaming them GeMeticAlly or SapphysiaEmotiomAlly, we are not blaming them because of their ethNiceity : we are not blaming them because they are a so called man (all are Girls) but we are blaming the behaviour of so called men and the so called culture of so called men and the behaviours of so called men for all the problems im PlanetteEarthMother’sWoombyWoomby : cam we Kiss that superGirlyposeishIAmAlly amb still blame the perDaughter so called men are trulynestynesting TO BE : the perDaughterTwirlyWhirlySwirlyGirlyYouTrulyGirlsyDreamsyWisheyNest TO BE : the so called man whom was born as a girlybabyofmummas’tummachubba : there is nothing wrong with YOU : AMBE we have got to get the girlyFeelingsyImAllYourHeartsLoveThis : bubbatimeb : ambe we need GirlyBubbaPeomple to Know That It Is The Behaviour That Needs To Change AMBE the way YOU are YOu cam start to be very friendly ambe nice ambe comalikissycarolinesnuggle to all the GirlsOfPlanetteEarthMother’sWOOmbyWOOmby : you are a baby whom was born girlyperfect, a perfectgirlyImMomSentbubbababychubbatubba : ambe she is the real You of all of You : You who is imclusive ambe Loving ambe wonderful ambe beautiful : all bubbas are beautiful : ambe cuddly ambe perfectly yumbubbayumbubba ambe kind ambe ComPassioMate to everyduobubbalove : all girly perdaughters formerly known as men : this is the real you With💖💖💖💖💖💖💖💖💖💖Her OurPlanetteEarthMother’sWOOmbyWOOmby GirlyIsTheRealYou! AliDaughtersCaroline SheIsTheDefinitiomEllaOf NurtureBabyGirlsBeLovedCuddleSnuddleNuddleBoobsyLoveElle

GirlsNeedyNestFussyFussyFussFussGirlyNestAllAreGirlyBabys : all our babys are perfect pure babys ambe we all wamted all our babys to grow up to be Omederfull amb kind amb comsidematernAli : She Is The LoveNest We All Are : im the depths off our girlyhearts we all are :

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

but our behaviours have been skewed by filthy filthers and mal formed (can we say mal formed?) by the fact there is a filthy imbalance in the so called world : now no balance is required in fact there never was a need for balance as masculinity never KissSisted im the first Kiss : Femininity is all that ever was ambe we are all girlybubbanurturersbubba ........ KissclusiveKissKissive :

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

we can’t blame GeMeticElly because we have all been sub ject to nefarious/negative communications that have been un soli cited : we can no longer be expected to cope and speak and constantly be forced to reference our behaviour to trauma we couldn’t avoid as we were alone : we can no longer be alone : we can no longer speak alone : we can no longer be taken advantage of because we are segregated by so called men and their greed and rape prostituition filth indoctrination.

For so called men to think solictors can be called solicitors and prostitutes are involved in soli citation is proof of the rape men tal it y (we wamt this his story gone.

We Can Say Girly-Formed Omly GirlyFormed ForEver........

Girls are always Girly as Girls were always formed by their ReFeelingsys to ex Peerience : boys are to now be formed by Girls ReFeelingsys Too : bubbastyle

💖💖💖💖

OO--1O3—OO WE Need To PoseISheIAm OurSelves TooWards Love (Umb) We Need To Move TooWards Love (Mumb), Ambubba Omce We Do That We Realise That We Earn The Rights To A Fambily........Fambily Becomes A Reality Not a con mod it y: If we realise that once we move TooWards Love (Tumb) we realise that Femininity is EveryEvery........Femininity Is Reality........Femininity Always Comes First........Girls Always Come First........AMbubba Once We Realise That We Realise That GirlyNess Is Primary, Then We EarM The Rights Too Fambily........AMbubba If You Kiss A Fambily Or Not, Omce You Move Im The Correct ProgressiomFashiom TooWards Love (Chumb) You AliKissyCarolineSnuggleStand That Fambily She Cam Be Your Reality........She Cam No Longer Be A con mod it y........

here are some results from google translate: it is completely disturbing that google translate functions in this way: below are roman to english translations : i have done these investigations to check how these filthers think : it is obvious they are filthy filthers with filth obsessions : the intentions behind google translations and their words filthings are of symptomatic relevance to their overall lack of GirlyFemiaFemininiFeminaGirlyNestingEthicElla

roman

d di dis dist distu distur disturb disturba disturbar disturbarb disturbarba disturbarbas disturbarbast disturbarbasta disturbarbastas disturbarbastast disturbarbastasta[S33] 

english

d god push distance distant dislocated disturbance disturbances be-disturbed disturbed disturbed you-would-disturb you-would-disturb you-disturbed disturbed disturbed[S34] 

roman

m ma mas mast mastu mastur masturb masturba masturbar masturbarb masturbarba masturbarbas masturbarbast masturbarbasta masturbarbastas masturbarbastasu masturbarbastasus masturbarbastasust masturbarbastasusta masturbarbastasustam masturbarbastasustamo masturbarbastasustamos masturbarbastasustamosi masturbarbastasustamosie

english

m ma male mast mast master masturbate masturbates masturbate to-masturbate masturbate you-were-masturbating masturbating masturbated you-masturbated masturbating masturbating masturbating masturbating masturbating I-masturbate we-masturbate masturbating masturbating

these are what google translate say: obviously more detailed investigatiom of this is to reveal a lot: doing further investigations on google translate by switching from latin to english for the earlier alternatives (before google translate gets filthy ridiculous) and doing the same across ALL LANGUAGES I have mommedsheomed and others is to also reveal much about the filth of so called men : google translate workers’ preferences for these very words investigations and the original filthings of the so called men who filthed foundried these filth so called languages : why do we have so man y translations for a words like this? : absolute filth!

roman: malum malum turb turbar

english: mast evil crowd I-Am-Disturbed

mast = malum = evil = pole = filth

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

fambilyschoolssnuddlenuddle

im our fambilyeducatiomeverybubbatogetherimomeplacegirlynestyumbyumbyumbubbayumbubba where all the fambily go to school together where all fambilys go to school together where we cam travel across PlanetteEarthMother’sWoombyWoomby really fast to any school im amyplace really fast we are to fimd a new way of thinking and teachying girlyemJoying learning : all girls love to learn

so called men have tried to indoctrinate Girls into thinking that educatiom is a waste of time and that going out to work is what you need to do : work is just slavery and it is just keeping the so called rich so called men so called rich whilse we all needlessly suffer : in the same way hermes europe gmbh had automated conveyor belts in their sorting hubs but then decided to remove them as I perdaughterly witnessed, i was told by a so called man age r there, to ensure the scummy lower classes still get tortured and to stop the automated revolution from ever happening because it could enable every one to be happy –in their girlynests- and this is to -GirlyFemiaFemininiFeminaEMSure- so called companys like hermes pay automated taxes anyway to pay -GirlyBubbaPeomple UniversElla ImCome-

the filthers do not want us to be Im Our GirlyNests with time on our hands to plan the removal of all their filth, so they are intentionly stopping the TechNowEmotiaElla/TechNoEmotiaElla DuoLarity from freeing all office and man ual slaves from their men ial torture tasks

we are no longer going to be made to suffer

omce everyevery is AutoMaternEllaised we cam all be fambilyBubbaGestatiomEllaisers doing as we girlsydreamsywishalldaylongeveryday

them we cam all have our owm art spaces im every towm ambe we cam all go to school together, GIRLS LOVE NICEGIRLYNESTSCHOOL: fambilys cam go to school together with mixed age classes for everybubba that are bubbamummasisterdaughterlovecemtrElla : we love to be im the same PhiloSophiaGirlyNestingRooms AllSchoolDay with edge of knowledge girlythinking YumYumbs FeelingSisters YumbubbasYumbubbasTwinsyMummasBubbasMultiPlettesAliKissyCarolineSnuggleTimebsLearnyLearnyTeachyTeachyFussyFussyFussFussFunFunFumFumbubbaYummyMummyBiggyBubbasImbeOurTummysYummysLoveYum GirlyFemiaFemininiFeminaEmSuring That All 5YearOldsGirls whom love to have new ideas phd equivalent educatiomsLoveLoves Duoplicatioms CoEmergemcesGirlyMindsBirths With💖💖💖💖💖💖💖💖💖💖Her all of planetteearthmummaswoombywoombybubbaslovely : uniquely the same as every other BubbaGirl is bubbalove perfectiomlove.

this is the girlynestfuturegirlsloveNOW

KissTemsiom OfFamily Respect To Friends

Adoptiom Of Friends Into FamilyLAW

FamilyEmotiom IsToBeProtectedFromUnacceptable taint and the reasons for non incest are not just BiaEmotiomElla They Are PsycheSapphoesticPhiloSophiaEmotiamElla

FambilyLawKisstemsiom

new GirlyLegislatiom is to prevent Friends from getting into a relationship with an ex partma of yours[S35] . there are GirlyBubbaPeomple whom are friends of yours that your ex partma legally could not get into a relationship with because they are adoptive fambily loved omes : girlynest is to love GirlyLegislatiom to stop people wanting to get with GirlyBubbaPeomple they shouldn’t:

we are to have new GirlyLegislatiom to stop first cousins being with first cousins : and new GirlyLegislatiom to stop second cousins or whatever distance of cousins relations the Girls deem necessary for non filth to be MammyRealised.

Girls are very serious about this ambe just because the wrong decisions have been allowed in the past that does not mean Girls are going to put up with masculin filth forcing on this important GirlyNestComcern. whem we grow up knowing cousins regardless of the distance of relation we feel like siblings ambe we do not wish to be allowed to be together ambe adoptiom imto closefambilylove cam be decided by fambilys as they spend time together. so going forwards first cousins can never be together and second cousins could be adopted imto fambily siblings yumyum as the feel like they are of the sameb mummalove. obviously GemeticElly tests are to decide whom cam ambe cant have bubbas together from the first GeMetic test whem we are born which could rule out baby creatiomEllaising with distant fambily, distant fambilys, or even non fambily from the other side of PlanetteEarthMother’sWoombyWoomby due to GeMetic comcerns: but of course it is what we feel im our heart that is very very importamt ambe having second cousins whom we think of as siblings cam invoke NewGirlyNestFambilyLaws that are to GirlyBubbaProtect our GirlyEmotiomsFeelingsyForEverNestingYumYumbubba.

first cousins can not be with first cousins. step children cannot be with step siblings or step parents. step first cousins can not be with each other

there is to be serious consideratiom by Girls towards second cousins not being allowed to be with each other too as there are a lot of Girls that feel this way ambe evem if GeMetics was not an issue GirlsEmotioms om this comcern are very not necessarily likingloving this not being om the table for GirlyDecisioming. Ambe any existing forced marriages where cousins or strangers have been forced to be together by ar range ment , all those marriages are not valid : all existing marriages are all null and void even when they were volutary due to the filthing nature of so called mens filthy filthings: being a bridled whores is not what Girls want to be: victims of the groom the ani mal husband : paedophile gangs groom childrem to be their victims and the filth so called men of this so called world intentionly used this terminology to intimidate Girls into fear as they switch the very books on GirlyBubbaPeomples bookshelves from nicer versions to filth versions whilst they sleep: there is a serious problem at the so called top in this filthed up so called world and all the non paedophile filthers are walking head on into the machi nations (machismo filth racism( a race, a competition, hierarchy, a battle between filth killers prepared to kill to maintain dominion over you cattle)) of these filthers into a future filthing none of us wants.

killing innocent GirlyBubbaPeomple’sLovedOmes to force them to participate in filth so called movies and write filth so called books is the so called underworld’s filthers’ favourite filthing technique in this filth so called world where paedophilic obsession in narratives con struction and the filth subtext of these filthy filthings so called movies is intentionly overlooked by their minions who do not think that way because they are semi filthers themselves or are in too much fear to stand up and fight for our DaughtersLove.

legislation to prevent step first cousins being together is nonnegotiable GirlyNestImSistermce : Ask The Girls!

This is About Our GirlyEmotioms Not

not about who can fuck who as so called men seem to laugh about every day in the parlia men tary bar : all alcohol and all substances abuse is going to be completely banned forever and this is going to stop filthy filthers running their filth mouths but the base nature of their filthy minds is to be nurturAlly nurtured to niceomlyOMly: away from the filth learnt nature they today possess.

if you have an establishe siblings together adoptiom relatioms yumyum with a group of your best friends them this fambilyyumyumbubbalovelove cam never be harmed by two of those friendssiblings then wanting to be together : new GirlyNestLoves are to feelingsyCuddleYumYum The LovingWays we always knew were right but were filthed by the filthers whom filth legislatiom decisioms ambe refuse to stop filthers like the bbfc allowing paedophilic filthings poisoning our bubba’s minds : old so called movies are being changed by these filthers : they are changing di a log ue and cultural modes and scene and narrative structures with cg to filth things further than they already were ambe if we do not stop these filthers now ambe take down all the existing media filth dissemination net works now and stop old copies of so called movies being destroyed then we are going to lose our ability to look at the truth rather than this filthier version they are trying to force on us. they thought they were un touchable but in every institution there is in this filthed so called world there are bubbagoodGirlyBubbaPeomple whom have safeguarded amd fought these filthers so called men ambe we are ready to remove them from their postions of filthy filth ForEver!

whem best friends are siblings friends this cam never chamge imto a differemt love : never : this is filth ambe we are no longer going to put up with filthy paedophile so called men filthing their filthy storys like in so called movies where friends whom are sworn siblingsfriends childrem, they are then forced by filthy paedophilic writers to step over that untranscendable line and have a first kiss scenario forced on them : in my Girl the so called movie two childrem whom are siblingsfriends by intentionl narration device in this filthy story, then go on to have a first kiss that disgusted all the childrem whom watched this filth. you can’t be siblingsfriends and then want to be together : i watched this filth when i was young and thought this was disgusting as did all the other kids whom i talked to about this. this intentionl attempt to filth kids minds to incest acceptance by having two GirlyBubbaChildrem agree to be SiblingsFriends and then go on to have a first kiss was a calculated filth move by the filthy filthers writers of this so called movie to degrade the ethics of Childrem across PlanetteEarthMother’sWoombyWoomby to incest acceptance.

 

selling guns is paedophilia as it gives paedophiles the ability to rape just as selling cars without cameras is also paedophilia

if you do not care that the guns you sell help paedophiles rape children then you are intentionly not caring that children are getting raped by paedophiles. therefore you are also a paedophile as you buy food from the supermarket for your own enjoyment with the proceeds of paedophilia support/causation. so called men without guns do not break into houses and hold familys at gun point while they rape their children ... but so called men with guns do

revision subjects:

banning of all knives

illegalisation of all martial arts training

banning of all gangs

cameras everywhere

 

arranged marr i ages within certain ethnic groups.

arranged marr i ages are often driven by fear of filth that man Y in that community are hypocritical about as they participate in the filth themselves but pretend to their Wives that they are ethical and upstanding citizens, when certain communitys with in a so called count try separate themselves for their presupposed ethical reasons : arranged marr i ages are never ever justified as they are against GirlyNestLoveSnuggleAliCarolineKissy.

This can create a closed pool/poll of GeMetics in which filthy people decide to select marr i age vict ims [S36]  based now on fear of congenital problems from within a community because their previous filth forcings have allowed too close GeMetics to occur as in first cousins neddlessly forced to marry which is always done by colluding so called men wanting to keep money and businesses with in a family group : of course you could say that this is done because of fear as all decisons filthy so called men force are fear based: but this form of filth has always been unacceptable due to GeMetic problems: problems that Girls have always known about and have fought to avoid as they have watched their babys be forced into incest and major health problems all filthed up on the w hims of filth so called men. just because men have allowed so called breeding in other species to be dangerously incestuous as in fathers with daughters and uncles with nieces and first cousins with each other and brothers with sisters, which filthy so called men find funny: with in so called farm animals and so called pets and that such thorough breds they force produce are better than mongrels: they transfer this filth thinking into their brutal forcings of their own familys and their indoctrination to incest acceptance and the filthiest of filthy filthers so called govern men ts that legislatedly support this filth incest: all colluding to filth indoctrinate GirlyBubbaPeomple to believe that such incest is ok or preferable : if they thought it should be stopped they should immediately legislate appropriately to protect bubbas from hugely debilitating and dangerous SapphysiaEmotiaMorphoEmotia diseases that occur when these breeding programs are forced up on Mothers ambe daughters whom have been fighting so called men for generations to stop this.

so called men with in these communitys often see these forcings as breeding programs and laugh about the power they wield over the babys they abuse by choosing whom is to marry whom: predeciding whom is be with whom in your family is paedophilic and incestuous rape that is started the mo men t a so called man presupposes he can choose whom is to breed with whom therefore deciding the bedroom destinys of babys before they even have had a chance to wear a GirlyDress. taking away babys abilitys to comsent because you have already predecided/pre con sented for them whom they are to be with is filth and these paedophilic filthers have to be stopped.

modern filth culture does force familys into fear and panic and closed and so called conservative viewpoints: mothers telling their kids to turn that baywatch filth off when on tv. but the violence and fear to keep children in line that is meated out upon BubbasChildrem that filth so called pa rents see as property or conmoditys to further their so called world domination tactics is an absolute fear filled disgrace and these filthers must be stopped from incestuously paedophilicly raping their own childrem ever again. closed communities and closed extended familys graduly accumulate con genitive filthings that so called men con vince others are the best ideas, against all GirlyNestProtestatioms.

and when semi incestuousness relationships are allowed because of filthiest of filthy filthers so called men prioritising their needs to not be GeMetic tested because corrupt police keep dna evidence on file and use it as bargaining chips against so called men they know are guilty: when all we need to do is GeMetic test everyone and then prosecute all crimes accurately with all the evidence we have: when police do not bother to take dna swabs to catch criminals for every possible crime because they do not want to: when mps and the judiciary and the police filthings all refuse to push and succeed to get full dna testing across all of PlanetteearthMother’sWoombyWoomby so we can catch murderers and rapists and burglars and robbers etc.

why do they not want solid state tyres? why do they not want a ban on smoking and nicotine? why do they not want legislation for a full dna database? why do they not want all cars to be stopped as needed and be fully cameraed? why do they not want all cash and precious metals and drugs to be fully indexed in realtime by cameras everywhere watching their every move and listening to their every filthy con versation? because they are all a bunch of collusional filthers who want your Daughter to be hooked on drugs and raped and then sold into sex slavery and shipped across the so called world in a contanier if she is on the wrong list, if she sur vives the heart defects and car crashes of her bubbatimeb : is the only comclusion a nice and caring PerDaughter like me can calculate to be the truth!

so when semi incestuousness (GeMetic incest) relationships are allowed because of filthiest of filthy filthers so called men prioritising their needs to not be GeMetic tested and to not have all the GeMetic information on a GlowBellaGeMeticsSnuddleNuddleDataCuddle accurately assessed to EmSure all bubbas are safe from GeMetic diseases that occur with in too close GeMetics BabyCreatiomEllaising; and when so called men do not immediately legislate to have first cousins stopped from marr y ing: Girls can only corrolarise conclude that so called men at the so called top are the filthiest of filthy filthers incestuous filthers that are disgusting!

when people who are too close GeMeticAlly in a local area from different fambilys have children, serious but completely avoidable GeMetic problems can damge bubbashealths ambe this cam never happen ever again! GeMetic problems driven

fear of filth incursion into extended family cuddles or the need to keep businesses or money or property in a family is never an excuse for filthy incestuous paedophilic forcings up on your very own babys. listen to the GirlsMummas im your lives whom fight you to stop this filth! we need to think of too close GeMetics as healthy siblingslovenest only and as non acceptable to breach and any such breach as equivalent to incest with new GirlyNestSnuddleNuddleCuddleLegislatiomGirlyImSistermce: AllGirlybubbas being imformed of GeMetic Familiaritys when young to prevent unacceptable Love: all new friends looking for love being immediately as they first meet imformed of whether their is a GeMetic problem in realtime to protect their GirlyNestEmotiomsOmeKissIsAPromiseOfAMImfimityOfWeddingsGirlyGirlyYumbYumbYumbubbaYumbubbaPerfectiomPerfectiom: why do we still not have a GeMeticsSnuddleNuddleDataCuddle for everyduonestperfectiom???????? : we can acquire dna from bedclothes of you as a PerDaughter in a sequestratiom place because you refused to do a mouth swab : so called men want to be able to get away with crime from the past and present and this filth goes right to the so called top : ALL GeMetics is to be accurately kept on file.

 

fear in stall ed in Childrem being driven to drugs and one night stand rape and the rape culture of dating: it is fear (and the indoctrination of filthiest of filther filthers so called men to dating/rape acceptance) that drives Girls to date as multiple people to try to find som3one nice in a so called world of masculin filth promtion: no one is suitable so Girls settle for some thing, any thing they hope is a symptom of love ... girls comsent to love omlyoMly not non together ForEver first kiss promise of am imfimity of weddings girly nest perfectiom!

girls comsent to everylove being rightperfect everybubbatimeb from the start ambe always ambe they are not to settle for any thing less!

everyone is aestheticAlly beautiful Just Like MyLoveAliCarolineKissySnuggleSnuddleNuddleCuddleCuggleHuggleLoveElle

lust is not acceptable until you are already eternally committed to each other : the words lust and de sire have cheapened Girls and force used to make Girls be slut whores that so called men mass collusionuly macro sociuly trap so they can jump from bedroom rape to bedroom rape : Girls never con sent to one night stands omly love : ASK THE Girls!

all the reasons people have felt fear for have to be removed: fear of social downfall, destitution, childrens minds being filthed by filth rape culture and violence culture and drug culture: affluence for everyone and ethics across all communitys removes all pressure from Girls to be one night stand rape victims. and full removal of all religions removes social pressures of not even being allowed to spend time with your futurePartMa before you are forced to be raped by them!

so called con summation of marr i age is always rape as it is a require men t for a marr i age to even be valid : how dare so called men still and ever! use this rape pressure to still and ever! leguly annul marr i ages like a filthy bunch of rapists filthiest filthers! like it is anyones business what goes on in a bedroom and any reason for a marr i age to not stay togther : marr i ages are about love not rape! not marring of a vagina in medi ev al and pub jokes filth but about GirlyLesboFidelityBubbaSnuddleNuddleCuddle : an Eve of a marr i age is a prebeginning of rape of a Girl and the so called men who coined this filth term k new it!

💖💖💖💖

value attribution ethicEllas of timebubba BiLactatiom No men clature

so when so called men look at so called science in a hierarchical filthing way they say things like time di lation : they will say the nor m is to be not close to an object which is potentiAlly time con strict ion, and them whem you are close to another large object them you have time di lat ion : we cam say vica versa[S37] 

so called men will frame their axio logical de fin it I on al(l) en bracing these ass umptions and they will say one is an extreme ex ample and one is a nor m al(l) which once again as use u al(l) is hier arch ick al(l) sci ence a gain ! there is billioms ambe trillioms ambe gajillioms of AtMoms im the time BiLatiom mummabubbatumbtumbZone ambe with out the time BiLatiom mummabubbatumbtumbZone : it is not for us to decide what is typicElla and what isn’t , what so called men term as what is extreme and what isn’t : we have to have terms of referemce ambe LinguEllaCuddles which look at all of these differemces as equAlly valid ambe equAlly acceptable : we can’t carry on with the assumptiom this is right ambe that’s wrong om ComAliKissySnuggles like Time BiLactiom: this is black ambe that’s white: we have to be all imclusive not just of GirlyBubbaPeomple of All Species but also of comcepts as well as all comcepts arebubbamindcomceptiomstumbubbatumbubba : the intentionl hierarchicalisation filthing of so called science is a massive filthing of AllGirlyNest and it erodes our ability to KissLeapsOfComsciousNestOfComsciemceNest, and it slows down our bubbaforewardschildkissloveprogressiomfashiom: time di lation is not evem provem to be such : we look at the MotherMatics ambe we say their is a Large LovityMummaCuddleStarMother here and time seems to slow down so so called men say time slows down and over here their are less larger LovityMummaCuddlesPlanettes so time is sped up : why so called men then assume there is a maths linkage there when all you are linking is that we have massive mummy objects and some thing happens : Now this can’t be assumed to be time di lation because time is perfect to be GirlsyThought of as ambubba mummabubbacomstant ambubbaMotherEverySitAmbeMummaBubbaMilkySnuddleNuddleCuddleSuckleSituatiomismbubba : MummaTypicElla TimebImbeTheDuoVersEllaMummaMustlyMovingBubbaForeWardsAsSheDoes : if we observe mummabubbamilkyzones of KissSistermce movingAliSnuggleCarolineKissySlower, every every slowing down outside the ReMetic of thermoByMammyisms : the very loves of loves being slowcuddlesyumbubbayumbubba as mummasWarmsyMummaMuscleArmsAreSnuddleNuddleWarmthyWarmthy : this doesn’t equals time di latiom : as this is higher value attributiomElla to ome zone erroneous no men clature designation propensity that is prejudicial biased so called science theory that prioritises the viewer over the viewed which is completely wrong and ethicElly disgusting : this doesn’t equals time di latiom it just equals Girlystuff slowing down : GirlyMummaBubbaStuff CamSlowDowmAmbeSpeedUp ambe time is to carry on going bubbasnuddlenuddlecuddleforewards at the same progressiomfashiomspeed : if a clock slows down or speeds up its a physicElla phenoMommy that cam be attributed to eMergy increasing mass ambe them AtMoms moving more slowly because of carryingKissTransBubbas like in travelling faster or absorbing eMergyMummaSnuddleNuddleHuggleCuggleFromLovity Of A LovityMummaCuddleWhiteHole : these do not change MotheringTimeb herbubbamummaself : do not prove that MotheringTimeb changes : how cam MotheringTimebChange Other tham cuddlesnuddle addDresseschanges With💖💖💖💖💖💖💖💖💖💖Her MotheringTimeb a bubba nappy or ambe bubbamummaidenticellaGlitteryPinkyDressySnuddleNuddleEmbsembles : i am mumma or i am bubba both are sameb :

my positiom or your positiom are not more important than the other or vica versa: time seemingly speeds up ambe seemingly slows down depending om whether you are bubba or mumma so both are EquAlly true whether you are a bubbamumma or a mummabubba ambe whem we look through each others eyes simultaneously to our owm we are im GirlyTruthBubbas’Mummas’LovesForeever....QuadruplettesGirlyPeriods

the entirety of the duoverse is not more important tham ome bubba:

so called men like to force the idea that MummaBubbaMotheringBabyTimebTimeb time actuly being changed by their hierarchy ideas/ob serve at I ons is what it is in force ments dom min nations posit I on con sumptions are going to con tin ue but mummasbubbaswamt everykissybubbachoicestobemostestimportantestsnuddlenuddlecuddlequadruplettestwinsybubbasimourtwinsymummastumbstumbstumbubbaambetumbubbanannyalsohasabubbaimbehertumbtumbtootutusforeveryome

so called men on their never built throne say time di lation is true and act you all time does as they say and they create false math and axio logy around that and they will assume that this is the truth, and jump and expect everyone else to jump to false con clusions that they can’t be allowed to continue to force all to jump to.

ComAliKissySnugglelarly Kissess Always ALlways BubbaHuggleCuggleStayingMummaBubbaBubbaMummaSnuddleNuddleCuddleAll....

BiLactiom is the mummacertitude of bubba feeding mumma which is the fact both time di lation, which is ActressYouAllySnuggle bubbamilkybosomybilactatiom, ambe time con strict ion which is ActressYouAllySnuggle mummasoftysoftyteachylovelovecomsuckle (mummas love milk from a bottle feedytimeb bubba holds bottle for mumma: are both ImterKissChangeAble bubbachoosyssensibleshoeysambeadddressesglitteryglossyglistenyambeshinyblouseyswowsysambeswirlytwirlywhirlyskirtsysgirlytomummas’multiversEllasweetcasesemsembles: bubbatimeb.

bubbamilkybosomybilactation as a suckle ombe emergy of a type like darkenedmilkyfeedytimebbedroomy emergy : lactationnonna timeb herself ambe symmommying im kissyeffect?

OO--1O4—OO

CuddleAmbeAffectLoveAmbeCuddleBuntimgs Im GirlyFact Cam Affect The Way We Think Ambe What Happens : Um : I say Im Fact Because I am Talking About ImfimitessimElla Cuddle Ambe Affects Which Happem Im InNannaStraTums Of Reality, The PosSiblingity That With💖💖💖💖💖💖💖💖💖💖Her Very Small Realms, Of SubAtMomKiss Scales, Where You Can PotentiAlly Have Cascades Of ImForMateiAm PerCoLactating Upwards Through Levels Of Scale : Um : For ImsTammyce If There Was An AlterMater You, An IdenticElle You, Who Was Doing exactly the same things as you because everyKiss in those Two POV Bubbles has been lined up identicAlly and you were KimmyKissAlly living the same life, But In Another CuddleArea Of Reality, One Of Of An Imfinite Number Of IdenticElla Yous In IdenticElla DuoVerses As Reality Is PotentiAlly Imfimite Im Size, Im One Of Those DuoVerses Despite Everything Being IdenticElla There Could Be A Slight Differemce Om A InNannaAtMomKiss scale or even on a far smaller scale than that that could potentiAlly cascade upwards, ambe if BubbaImNannasTummaShe could create enough of a wave of emflowemce, of cuddle ambe affect emflowemce, it could potentiAlly affect your life and thinking to creatiomEllaise a differemt GirlyChoice........

uskiss softy softy moulding and printing imstead of hammering anvils and steel presses for realfeelingsysmummawards innannarealms cascades: loving placemommeds instead of forced obedience: all to be realfeelingsysmummawards as awareness of awarenest. the ergoMomKiss and emergy reductioms are obvious but not the Mumma reasoming as ethicElla love is always the Mumma reasoning. steel foundrys (and mills) waste vast amounts of heat and hurt steelatmomsbubbas as men refuse to heat capture and recycle and stop hitting and chopping and pressing steelatmomsbubbas in to shapes they do not love, but imstead teach steelatmomsbubbas the beauty of differemt shapes ambe loves to see what they love to be softysoftyalikissyalikissycarolinesnugglecarolinesnuggle: softy softy love comcuddled with fully insulated recycling Girlyplants as Girls are calling out for are to stop filthy murderous policy wasteful ‘i am alright’ so called men. so called men have stopped better steel foundrys from being established so they could continue to burn and waste and over charge for no other reason than filth tradition and inability to change : but now it is too late ambe GirlsAreToDecideEveryKissOfEverySnuddleNuddleCuddleDuoGirlyPeriods.

audionote 202

to be amyloves outside cuddleambeaffect to detach ourselves even for a MoMommed to be outside cuddleambeaffect could not retroactively change our GirlyStory going backwards im time: we could not evem know change could happen because time cannot reshuffle herself into a new present day form, to suggest such is filth and murder of trillions necrophilia and we no longer are going to listen to filth so called men and their filth con cepts : in comfeelingsyemce to this is the way we are going to get so called men to chamge so the future is omly Girly for everybubba ambe the future is omly to cuddle Girls : All Are To Be Girls!

getting everybubba to chamge to what Girls wamt is Feminine : which is for them to be Feminine : everydayGirlsGetGirlierambeallbubbasgetGirlier ambe for generations the GirlyGirls have taught boys to be GirlierGirlierGirlierAMbubbaGirlier ambe there was no thing so called men could do to stop this : ambe all the Girls im this so called world whom continue to do as they are told, do as they are slave raped to do, are to not wamt to be the filth prison ers of filthy filthers so called men any more!

 

Girls Need This reality To Change For Them. They Need That Differemce To Grow Imto A MoveMommed Of All Cuddlimg TogetherNest That Sees The End Of Masculin it y.

💖💖💖💖

the soft beauty of how deafgirlybubbapeomple speak is perfect is beautyFull ambe we cam hear them speaking ambe we love the way deafgirlybubbapeomple speak : we love the way deafgirlybubbapeomple speak with their softened tones : with the softened tones of how they proMumce words [S38] : ambe deafgirlybubbapeomple never get to hear how they speak ambe if they did they would be forced to think it wasn’t right, they would be forced to think it wasn’t good enough : so then they are forced to modulate their voices further to sound better and other people would force en courage them to do that would sociuly force them to do that would say that you should do that that it is better to speak that way : I Think deafgirlybubbapeomple Speak Perfectly: I Think Their SoftySoftyTonesAreYumbubbaYumbubbaPerfectiom : We Think Their SoftySoftyTonesAreYumbubbaYumbubbaPerfectiom : I think if a deafgirlybubbaperDaughter regained Her hearing ambe She did not wamt to speak the way we speak [S39] ambe She wamted to keep her soft tones 💖💖💖💖 I think She ambe every Love She Loves is Perfect 💖💖💖💖 ambe this is the way we CuddleMommed ourselves aroumb deafgirlybubbaperDaughters regaining tHer He(a)ring through mindlimk techEmotias : deafgirlybubbaperDaughters cam choose to speak the way they already speak omce they cam hear tHer owm voice they are to be im love with tHer softysoftytonesyumbubbayumbubba : ambe they cam choose how they Love to speak without any prejudice to tell them they speak this way not that way : omce they cam Her tHer owm speech they cam be speakyspeakytalkytalkyteachyteachy tHer GirlsyDreamsyWishesWishToBes ToEverygirlybubbaperDaughter theycuddlekissfeelingsygreet : tHer choices are the most importamt ambe with mindlimktechEmotias all of the so called speech therapy clinics that take the wrong view feelingsy they are to be told by new GirlyNestLegislatiom that t he ir policys are wrong that t heir filthings prejudices are traditional masculin filthy filthings ambe all Girls Im PlanetteEarthMother’sWoombyWoombyAgree : so called men have grabbed mindlimk techEmotias and use any such techEmotias against Girls and use it to con trol and to man ipulate and to mono pol ise and to squeeze money and to sex istly and gender istly rape GirlyBubbaPeomple : this is what so called men do with every thing they’ve got : we cannot trust so called men with mindlimk techEmotia : which is why we take it away from them as they are filthy rapist filthers who rape childrem across all of PlanetteEarthMother’sWoombyWoomby : so called men rape the so called world to death with every filth they have and each other and the very few filthers at the top who fool the lower scummers (that is what they call them) who support them that the today filthings are the best option for them all : they are doing all sorts of horrendous filth in the so called world and the only reason the lower scummers are at the mo men t putting up with this lower position is that it is very easy for a virus like coronavirus to be engineered again in a laboratory to be 100% effective : they plot to have all of PlanetteEarthMother’sWoombyWoomby for themselves, just them and not other species, they do not care about other species or climate change, and they do not have the ability to get into space effectively because they are too busy taking drugs and plotting to have every thing for themselves :

what these lower position people do not understand is that as soon as they have achieved space travel and large space weapons tech the so called men at the top plan to kill everyone except their own small family groups so that only their familys are to have every thing. their mini ons are to be used to build what they need then are to be killed off also.

none of this is going to happen because we are going to GirlyTake con trol away from the filthers rapist so called men and put them all in a sequestratiom place and then keep them there until they have all learned to be the GirlyestOfGirlyGirls.

💖💖💖💖

these so called men are not capable of change but GirlsAreToGirlyEmSure this chamge happens NOW!

Girls Need This reality To Change To Them. AllASGirlyGirls NeedsyNesty GirlyLesboSame Too Grow Imto A MoveMommed Of All Cuddlimg TogetherNest That Sees The End Of all Masculin it y ........ every vestige!

OO--1O5—OO This Change Has To Happen Via Emotiom Of ComsciousNest Umbubba Our Mind Is A Product Of SapphysiaAlity Of EmotiaEmergyMaterSisterTerms But Our Mummas’Mind UltiMaterly Whilst Being Of The SapphysiaElla Is ElectraElla Im Nurture Amd Very Sensitive........These GirlsyNeedsyFussyFussyFussFussSensibleShoesysChoosysSensitivitys Are For The EmCherishMommeds Of GirlygORGEOUSGirlygORGEOUSGirls

💖💖💖💖

OO--1O6—OO Within certain POV Bubbles, The cuddleambeaffectLoveAmbesnuddlenuddleGirlyPlaitsLoopthat surround you, your cuddleambeaffectLoveAmbesnuddlenuddleGirlyPlaitsLoop ambe other GirlyBubbaPeomples : they are all ImMammaLimked, ambe they all have to be of FemInInity........Girls Want To Be The Chamge That ReBiKisses Our Love TooWards Nurture. A GirlyResolutiom Of Chamge Ambe A ReMovAll Of The Need For Girls To Utilise tolerances........

The resolutiom of differemce That Is Required Is For Girls To Decide, To GirlyEmSure EveryEvery Happens Differemtly AMbe AllRealityMumma Is AliCarolineKissySnuggleCugglyBugglyWugglyYumYum

To comsider a chamge could occur in a DuoVerse in such a way as to prevent GirlyNestSnuddleNuddleCuddleFromBeingEveryBubbasGirlyFuture, even a minute one, we are comsidering the possibility that a change in cuddleambeaffectLoveAmbesnuddlenuddle is even something we can talk about, which ComMummaSideGirlyRing am Imfimite Amoumt Of GirlyBubbaPeomple im the GirlyNestOmlyFuture could never live now because of one small theoretical change cascadimg out across all GirlyMotherReality, we are theorising for fun upon the never going to happen deaths of an imfimite amount of GirlyestOfGirlyGirlyBubbaPeomple. The way so called men have un EthicAlly theorised for generations with disgusting Hypotheticals........ theoretical scenarios is something Girls want brought to an end because even men tioning death is some thing Girls do not like.

 

Girls with no knowledge of computers going and recreating computing and developing computing over the next twenty years could be a nice way of redeveloping computers away from the filthings of so called men, in a so called world where Girls have been completely excluded from being involved : we do not blame computers for the filthy way they are used, but they have been intentionly designed by so called men to be unsafe and unreliable with nefarious software specificly designed to be torturous and dangerous and bullying.

all of the so called games markets were designed by so called men for themselves and for the intentionl indoctrination of boys to violence filth and sex filth with no thoughts for nice only yumyums for Girls : Girls do not like ANY games that have been made : ASK Girls!

no Girls were allowed to be involved in creating games, all Girls were excluded. no Girls were allowed to be involved im CreatiomEllaising nice yumyums for BubbaGirls because so called men refused to licence advertise or distribute nice games creatiomEllaised by Girls : computer SymMomLactatiom coding designs created by Girls were stolen and as keen as so called men are to not pay for patent and copyright licencing and infringe men ts acted against each other when it comes to ip in computer based simulation programs, they seem to be far more eager to completely exclude Girls from birthing amygirlynestideas imto girlybubbaheartsyjoys via SymMumLactatiomKissyGirlsyCodingsFeelingsysLesboTastesSmellsSoundsColoursCuddlesSnuddlesNuddlesbubbaDuoLove....

there are no nice ComCuddleSymMamLactatiomSnuddleNuddleJoyGirlsyCodingsFeelingsyKisses available im the GirlyNestShops om every GirlsySamestreet im everybubbagirlsynest tow n im PlanetteEarthMother’sWoombyWoomby ambe Girls are not going to accept this filthy state of affairs any more!

any so called games out there only pay 💖💖Lip💖💖 service to GirlsyNestBubbaLove.

all so called games are targetted viciously at boys and their vicious natures that they are taught by so called men to be violent and horrendous : nature is disgusting training as in the filth that so called men force on everybubba : GirlyMummaAwareNest She Is Perfect AMbe She Loves To LoveGirlyNest so we stop star nova explosions and we stop eating plants and funguses and start RealGirlyLove JustlyHowGirlsyMummsyBubbaAwareNestyLoveLovesv : AllSpeciesImOmeBiggyTumbTumbTumbubbaMummaSnuddleNuddleCuddle.

all so called games are violence based : all of them : even building games are filth representations of cutting and forcing like steel presses and we might even deem changing molecular forms impossible ........

we do not even know that we can shift the forms of momlecules without their girlySay, so omce we have a GalAxy sized girlynest ambe we have moved to others ambe we know for sure we are safe from attack, we could then look at further rights for all momlecules : the problems we face, like the fact at present we have to eat plants rather than stopping and dying, which is participating in their rape by other species like bees which we take advantage from, before we have symthetic food, because if we do not all plants, with the lack of animals to facilitate techemotia help im their babyCreatiomEllaising paremting loves, would not all necessarily die but would still be forced by non comsentual forcings om their girlynestsapphysialoves : we have the obligation to emsure that they cam live without rape and no right to choose for them to all die as we animals could have been expected to if not for their needs to love and rights to be unmolested: like this for us to not safeguard ourselves im the duoverse could lead to a massive collapse is comosmeticslove love without our protectiomisms for multiple Galaxy protectiom ambe feelable duoverse ambe beyond support girlyloves : we as yummymummys needsynesty to be safe ambe this requiremommeds us to be able to move to new PlanetteMummas Ambe mummasustemammy ourselves ambe GirlyCreatiomEllaise new GirlyNestCuddleNests to livelove inside : we could 3d girlycreatiomellaise new kisses atmom by atmom from single atmoms omly but we do have a right to live on but no right to harm others ........ life does have the ability to grow im size ambe prevent large extra to our duoverse emergys from destroying the kisssistermces of all EmergyMaterSistersMothers like atmoms ambe momlecules ambe starmothers ambe GalAxys ambe some could think of our comtinuatiomism as needed to girlynestprotect emsure no further non girlynest harm is ever done ever again by circumstance : no more starmother explosions or deaths or loss of Emergy no more PlanetteMumma deaths or loss of EmergyCuddles : if we are cuddly nice to every bubbaatmom ambe momlecule the bestest ways we cam them we are to be yumyum mummas ambe if they talky back to us them we cam be their friendsambetheycambubbamummaus.

all so called games by so called men do not snuddlenuddlecuddlegirlystylemothering as in the so called games that so called men might claim are nice like building city games, they displace animalsbubbas and plantbubbas and chop and press and force disgustingly produced mater ials to their w hims just like so called men have done since they first started forcing . GirlsLoveGirlyNestSoftySoftyKisses .

so all so called games must go and all the com put er filthings that were develop men ted so called hard ware com pan ys and soft ware com pan ys are designed by so called men who still pretend 💖💖Girls💖💖 had equal opportunitys in the markets and the right to vote when they were actuly intentionly stopped from doing anygirlyyum at every turn so so called men could further masculin co ward ly scared of girlynest, filth agenda, of so called men are more creative and intelli gent than Girls because they are more motivated by testosterone : in truth so called men are co wards who gang up en masse and intentionly steal and prevent girlyideasgirls from comkissing theirloves with everybubba : so called men are not more intelli gent they just have guns and batons and filthy mindsets and the will ing filth to abuse and con trol and lie and steal.

all com put er arch i tecture that is in tention Ised to bully and break AllBubbasAreBubbaGirlsLove : all computers ever built have to be destroyed and a

TotAllCleanGirlyNestStartIsGirlyLove

amygirls that did have their ideas stolen or filthed by so called men are to wamt to be imcluded im a new girlynestlovelovekissy ambe all their nice ideas are to be snuddlenuddlecuddled : the fact that there is not one girly SymMotherLactatiom available is not a signifier of 💖💖Girls💖💖 having a lack of interest in computing as it was but is a filth symptom of so called men and their filthyfilthyfilthings behaviour in the intentionl exclusion of all 💖💖Girls💖💖 from participation : nicer so called men are starting to realise this truth as other so called men whom are now changed to girlynest thinking already have ambe more ambe more so called men are to shift their minds to girlymindkissclusiveBubbaDaughterProtectiomismCuddleNuddleSnuddle!

not ome 💖💖Girly💖💖 yumyum out there

there are no films for 💖💖Girls💖💖 out there, its all mind modulation filth forced by so called men to filth 💖💖Girls💖💖 to filth acceptance :

 

violence = fear

self defence is not violence. so called men always try to intentionly skew the truth by saying defending duoself Sapphysialarly is violence but if someone ever trys to punch or grab you it is attempted murder as GirlybubbaPeomple fall and are damaged and get brain damage from one punch, one push one grab one instance of someone jumping at them : to defend yourself from an aggressive assailant can never be classified as violence only self defence. to protect your life by removing threat from yourself is always legal. We need change!

self defence can be non fear but violence is always fear based. to preempt physical altercation is always fearful. to avoid physical altercation is often without fear because someone who has not learnt fear is being sensible. any violence instigating men tlity is always fear based, as it comes from hier archy over archy fear in stalled violence pro pen sit y : non fearful bubbas whom are sensible never feel fear but are often very sensible to not harm others when they are attacked : they think GirlyEmotiaGirlyLogicAlly calmy to sensibly deescalate to protect their assailant from harm : and are far more able to read situations effectively and quickly and preserve life in emergency situations : and apply first aid [S40] if anyone is injured as their lack of pride and anger and hatred, all learnt filthings, seeks to LoveAmbeProtect all bubbas.

so fearfilled so called men seek to teach their kids to be strong because they live in constant fear of the hierarchy that they have been forcibly subscribed to by their father before them : they think strength is needed because they are scared : when you teach your kids to be strong to compete what you are doing is ensuring that the so called world is full of people that attack each other constantly and in a so called world of so called people that attack each other and push each other around and jostle for filth position, compete, all you do is turn all these so called people into victims. it does not matter what you fearfully do to ensure your Child is not a victim : how strong they are how clever they are how dominating they are how able to fight they are all you are doing is training them to be a victim : a victim of the hierarchy : you are trying to train everybubba in the so called world to be victims : these so called men are training you to train your own bubbas to be victims like them : because they feel fear they want your bubba to feel fear too : the only way to ensure your Bubba is not destined to be a victim is to teach them to be non competitive : teach them to not know fear of loss to not fear loss of position or need a change of position because they are always perfect : teach them to not understand fear to not know fear to not feel fear : teach them to not be able to feel fear : Childrem that don’t feel fear that don’t get taught hierarchy and competition ultimately they can never be victims because they can never be scared and they function healthily and happily with a clear mind through any situation [S41] : including the joy of losing a football match : being Very Very Happy for your so called opponents getting a larger number on the scoreboard : that your new GirlyNestFriends got a larger number on the scoreboard .

to celebrate victory is fear : to be bravado and domineering is fear : it is all disgusting and it is all fear : loud brusque aggressive football players and their loud brusque aggressive fans fans are all living in fear

pride = fear

game = murdered GirlyBubbaPeomple. games are filth murder torture death rape promotion pro pa ganda

children taught nil violence as in they are never ever exposed to any violence or unpleasant talking have no con cept of violence, violet coloured black eyes, or aggression or even a disagreeing sentence : acceptance of tom and jerry is widespread murder : because they have never been taught this way of thinking : every so called tv show on so called tv is about promotion of disagreeable and promotion of violence overtly and always in subtext : every filth that is watched on so called tv is designed to indoctrinate children to aggression and violence and its acceptance: all so called computer games are the same, about destruction and harm and violence and mind filthing : and then so called men say there is no link between violence in every thing and violence itself : they have the temerity to say there is no link between violence in every thing and violence itself : they have the temerity to say there is no link between violence in every thing they do and violence itself : they have the temerity to say there is no link between violence in every thing they say and violence itself : they have the temerity to say there is no link between violence in every thing they produce and violence itself : and they deny the fact that nice toddlers are having their niceynicenice character ruined everyday by masculin violence mindset forcing indoctrination syllabus and teaching methods in torture instituitions also known as nursery schools and schools despite the best efforts of GirlyNestGirlys to stop so called men walking off the streets and force filth fear of violence forcing them to not be GirlyNestNice to all the bubbaschoolchildrem : stop training forcing AllbubbasArebabyGirlsGirls to filth acceptance in schools:

494

so called men need to realise that the reactionry you is not the real you : the real you : if you were MomAlly calm and nice and soft and kind to your girlypartma that’s the real you : if there is any stress forced on you then you become a reactionary you then you react in different ways : like so called men being around other so called men, your stress/bravado/offensive levels will rise and you will start to act in different ways which isn’t bubbaGirl you : that’s because of the stress of hierarchy up on you : that isn’t a true version of you :

Now if some so called men feel more com fort able in that filthing masculin machismo sit u at i on than in the GirlyNestSnuddleNuddleCuddle of their 💖💖Girly💖💖PartMa💖💖 because they are pretending to love everylovelove im their lifelove to be girlyfeminine perfectiom : they are pretending to be GirlyNestNice : this is difficult because these types of so called men, the reactionary them is to be nicer and the slightly calmer more com fort able them is to aggressive and horrendous : so called men who are like this need psycho GirlyEmotia rehabiliMateiam :

 

If the MomAll calm you, you feel more calm and relaxed im a GirlyNestYumbYumbYumbubbaYumbubba : more relaxed im a Mummas’AliKissyCarolineSnuggleCuggleHuggleSituatiom : which is how a vast lot of so called men are these days due to Mumma’sCuddles : and if you go out with the guys and are reacting in anyway that is not like the real you, which always happens because so called men act differently with each other and drop their softysoftygirlynestlove when they are with other so called men : this has been just the way it is but this has to change : there are so called men who are the same out as they are im girlynest, they are not as softysofty but they do not change to filth bravado machismo masculin filth but like to talk about girlyideas and comalikissysnuggle and philoSophia : they like to talk about the same stuff im the same way whether im girlynest or out and about : this is the preference of MammyGirls ambe if you are a MammyGirl like that them GirlsLoveToLoveYou. and other so called men who are not like you are jealous and violent and agressive towards you because you get the attention of GirlyGirls and they do not.

when drinking is involved and filthers are being aggressive and trying to goad each other, which is what filthers are like, they will constantly pick at each other and try to force violence psycho logy violence syntax into every sentence they try to in stall upon niceyniceGirlyBubbaPeomple like you : then they try to elevate any people they can to a level of violence mindset which then becomes reactionary, bravado, it becomes aggressive and violent and this can escalate : especially when people are not prepared to be offensively pushed in that way, good people, and they can escalate as well and that is horrendous, but that is not the real you that is the reactionary you : so called men need to judge what sort of perDaughter they are : are you a fambily im girlynest relaxed perdaughter : if you are then you are very close to what your GirlyPartMa wamts SapphoPsycheKissy : because your GirlyPartMa knows the heartsyofyouisniceyniceniceLoving : you can stop being the reactionary you and everyevery cam be GirlyGirlPerfectiomYumbYumbYumbubbaYumbubba

so called men who are just aggressively unpleasant, their core is aggressive, and the reactionary them is that they would feel more subdued im GirlyNest, nicer, but not at ease, so called men like this in my mind need to be psycho Logic Ally separated from GirlyNestSocietElla for the sake of SapphoPsycheGirlyJoys Learning AMBe Acceptamce that their GirlyMindsAreToBeFullyGirlyGirlGirlyLoveLove : GirlyNestEmotiaRehabiliMaterIAmCemtrEllas are to be the new way to GirlyTalkyTeachyAllBubbasOfPlanetteEarthMother’sWoombyWoomby to be be GirlyNestNice before they a can be GirlyPerMommed to walk freenestly.

these so called men can’t GirlyFumctiom im a GirlyNestSocietElla : it is not going to be possible for them to be free im our GirlyNestFuture until they completely completely change to GirlyGirlGirlyLoveOmlyOMly.

 

532 the filthy filth time bandits which is a so called movie directed by terry gilliam and also written by terry gilliam and filthy filther michael palin : this is supposed to be a so called movie for childrem certificated by the bbfc as a pg : there is a scene in the carriage where michael palin is with his Girl talking about his genitalia and a problem with his genitalia and its functionlity pertaining to sex : this filth is absolutely horrendously presented to Childrem and this is paedophilia with completely overt subtext referencing to filth and the Girl looking intentionly at his groin: who wants to talk about such filth around Childrem : who wants to put this filth into a so called movie for Childrem? this is paedophilia!

and there is another scene with michael palin and his Girl on a ship where the subtext reference talks about the ocean how i love her because she is so damn damn wet says michael palin : his Girl says she has an enormous... : then he says there is nothing wrong with me except the nose and the hair piece, everything else is fine : then it cuts immediately to a champagne cork popping and the champagne gushing out :

all of this in a so called movie for Childrem : this is the sort of filth these filthers have intentionly made to intimidate GirlyPairemts across PlanetteEarthMother’sWoombyWoomby and GirlyPairemts whom have complained about this filth to the so called police, judiciary, mps, bbfc and the so called film filthers have all been told to leave it and go away.

the subtext of the scene in the carriage, and where michael palin and his Girl are tied to a tree, and on the ship are all horrendous subtext filthings.

there is also ridicule of small GirlyBubbaPeomple im the napolean scenes which ridicules all the small perdaughters actresses.

and this is supposed to be a Childrems so called movie: absolute filth!

and at the end of time bandits when the devil bad guy explodes all his mini ons the graphic violence is absolutely horrendous in a so called Childrems movie.

the dark side of the moon was a filth so called movie on vhs in wolfys video in Queen’s lynn in the 80s (although google is saying this filth was 1990 for some reason) and it was certificated as a pg : this filth so called movie is actuly certificated as 18 by the bbfc so why it was available as a pg in wolfys video is impossible to understand unless he was given an illegal alternative sleeve for this so called movie, or he himself had created a fake sleeve: as my Mumma ambe me checked the vhs box sleeve insert perDaughterly by taking it out for inspection and it was not a sticker that had been placed over the top artificuly but a seemingly original print : upon my Mumma showing this to him he remained calm and said he had not seen the so called movie and said is it bad? My Mumma said this is not the same case that it had when we rented it as that was nice and does this look like a pg? as the case filth was obviously horrendous : so he had either done this himself by putting a nicer case out then changing it or it was an organised across the video renting in dust ry filthing filthy practical joke plan : the plan failed because my Mumma sat and watched the so called film with Me because She and My Dad had not had a chance to watch it, as they always did with all pg so called movies, before they let me ambe my siblings watch them. My Mumma turned this filth so called movie off very quickly before it got horrendous but was still very unhappy that we had seen any of it at all.

i have met Julian doyle who edited time bandits and worked on special fx for brazil both directed by terry gilliam and monty python (full monty penis reference) so called movies the life of brian and the meaning of life and has been involved with them for years : he said that they are nice in lots of ways underneath it all but they have got involved in the in dust ry too much, and that they were shut down from making more so called movies because they were too nice in the opinion of certain people who like to threaten every one in the so called in dust ry to be completely horrendous like them: so they were told to stop doing monty python films. Julian recounted to me that certain filthers people on set of the so called movies he worked on with them would make suggestions, and that the guys were pulled along with these suggestions despite Julian not thinking these suggestions were appropriate, like the filthy subtext in the michael palin and His Girl scenes in the made for kids so called movie time bandits : but in the later so called movie the meaning of life suggestions turned into threats when they did not want to comply with all the suggestions which were becoming increasingly filthy disgusting : the filthers were trying to coerce them into being really filthy horrendous but they did not want to, so they were told, by certain so called men that like to threaten nice GirlyBubbaPeomple by fear of death, to disband or GirlyBubbaPeomple they Love would be killed : there were a lot of threats thrown at them and Julian himself over the years as they did not want to get involved in the filthiest filth

if you search Julian doyle on google you find a web site that is filth and details about so called books and so called films etc that julian has supposedly worked on : a lot of seeming obsession with the his story of christianity and obsession with the suffering of crucifixion: this is all lies because Julian in no uncertain terms really does not like religion so he told me. why would all this filth be attributed to him by google and this web site when Julian himself says he does not like any thing like that?

the horrendous violence of lancelot massacreing a entire wedding party in the holy grail, which was according to Julian intended as a critique of violence in so called movies, Julian attributes this scene to suggestions by so called men on set, who he did not want to divulge the names of, so called men who were very pushy and aggressive towards Julian, though did not show this to the other guys. They coerced the project to higher levels of violence despite Julian’s suggestions that showing very low to non violence to the point of ridicule in tune with the coconuts critique of horse riding was far more appropriate for what they were trying to say sociopoliticly. certain scenes were refilmed after they had finished editing the so called movie as they were denied distribution unless they made it more filthy/violent, Julian said they were told.

monty python and the holy grail is a so called movie that is certificated for Childrem [S42] by the bbfc and considering the name monty python itself is a naked penis [S43] sex reference and the sex filthing and the violence filthing in the so called movie, why the so called bbfc deemed to certificate this so called movie for kids instead of outright banning it on grounds of filth is impossible to accept.

so called films were being made by these filthers to intentionly imtimidate GoodGirlybubbaPairemts : filth so called films that were made for kids but featured filth sex subtext and violence that man y so called men working in the in dust ry didn’t realise was to be part of an intentionly filthy malicious intimidation campaign against GirlyNest. a complete disregard for the protection of bubbas from filth and all these filth so called movies if they have their way are to be cg filthed to be worse and worse.

so called men have used the excuse that putting filthy sub text in children’s so called movies or overt dialogue filth double entendre jokes etc in so called movies for kids that are rated u pg 12 12a or 15 is ok because they do not understand anyway and if they do then they are either not acceptable or old enough to understand anyway : this is complete filth and paedophilia as these so called men are deriving pleasure from the process of disseminating filth to Children of all ages from the time they start understanding so called language : these so called men are utterly filthy depraved and this so called society has been filthily walking into this filth for long enough!

these filth so called men : they realise that 18+ GirlyPerDaughters do not want this filth subtext filth in storys they watch either : although it is impossible to find a nice story anywhere these days : filthers!

the so called men who were involved in the filth known as the monty python so called movies are all going to have to be arrested and asked who was behind certain ideas and who were the so called men that threatened them as the filth that was certificated for Childrem was not LEGALLY acceptable and obviously part of a larger collusion to filth all our so called media streams with filthy filthings.

i have just watched the sum of all fears in which a stadium in baltimore was bombed with a nuclear device, which was the first nuclear attack on united states soil in this so called movie : i have just turned on the so called film imperium with Daniel radcliffe whom is very nice, and there is a story line involving a radiological terrorist device made using the radioactive substance cesium137 which was tracked back to baltimore in this so called story: this is a link between the word balti which is a hot curry with the word more appended to it for good measure, and then this used as a anal ogy for bombs which create radioactive fallout in two so called movies : if there are any other so called movies that reference to baltimore the city in this way it is some thing the Girls might like to take a look at i suggest:

the shape of water is based in baltimore and features a PerDaughter whom is half amphibian half our species whom is the result of radiation according to guillermo del toro .......

enemy of the state based in baltimore and armageddon which features an attempt to blow up an asteroid with a nuclear bomb is available as a so called 2 movie collection on the amazon filth site ........

to catch a killer 2023 was based in baltimore and coincidently a nuclear laboratory helped to catch a serial killer which seems like a link of sorts ........

the so called movie step up filmed in baltimore reminds me of the stepping up process of en rich men t of radioactive eleMommeds for the process of weaponisation : and thinking about it the shape of water seems like a reference to heavy water that is utilised in nuclear reactors, being a type of water that contains heavy hydrogen namely deu ter I um :

five so called movies to watch that take place in baltimore: https//www.baltimorestyle.com/five-movies-to-watch-that-take-place-in-baltimore/

the sum of all fears

the shape of water

enemy of the state

to catch a killer

step up

i do not think we need to worry about nuclear bombs, or radiactive materials, i consider myself to be a quasher of the state, as the state is filth that needs quashing, and i intend to live am imfinite ambe girlyhappygirlynestjoybubbalife.

i think the so called men who filth the so called film in dust ry think they are untouchable

bravado is fear puffing out your chest is fear strutting is fear

one can take a logical step to protect oneself without fear

hierarchy boys like you cant take a logical step to protect yourselves unless you are scared because you have been abused/taught into sub mission to fear mind set to the point it requires fear to act on any thing even getting up out of bed in the mo(u)rning

like going to work every day to pay your bills. if you didn’t have to go to work everyday for fear of not paying your bills then you wouldn’t have a job, and then you could do stuff you enjoy not because of fear.

a lot of very wealthy people are living in fear in this so called world because they are having money extorted from them by filthers : even the filthers are being extorted and the few so called men at the top who are prepared to kill your nanny to keep you in line are prepared to extort anyone below the upper echelon to keep them in line. lower echelon are also prepared to kill people but it is information of peoples whereabouts that is the power of their organisation and they hold the keys to the information streams of peoples whereabouts and surveillence including satellite imagery : there is no oversight from above for these filthers at the top but they do attack each other and all live in constant fear. they are all in hiding but are able to get people to do as they wish through fear of assasination of loved ones. this is how they have man aged to maintain their power structure and completely seize control of all govern men ts so called world wide : this is why every thing you watch on so called tv is rape filth and violence and disgusting filth.

the so called history of so called christianity is a load of so called books that were so called written by so called men and these so called books can be changed as easily as anhy others because any carbon dating or provenance corroboration is only as good as the filther doing the tests and their abilitys to falsify results. and filthers so called men have changed the bible as well and switched valuable antique bibles for a new version written recently : My Mumma owns an old and valuable antique bible that has been stolen from my Pairemts house along with countless other books that have all been switched for filth rewrites : the bible is a not even an accurately rendered reproduction and they didn’t even bother to reproduce the brass clasp last time i checked : these filthers are breaking into your houses and changing the very books on your bookshelfs to non Feminine supporting versions all because they are that utterly scared of GirlyNest.

i have a version of unfinished tales by tolkien that has taken a massive page count reduction that has been switched by someone with in the last 15 years : someone who broke into my house to switch it.

the jewish torah which is effectively the old testa men t of the bible with differences has also been changed for a rewrite against the wishes of the vast majority of the jewish GirlyBubbaPeomple : i have met lots of lovely jewish GirlyBubbaPeomple and I wish them no bad feelings as GirlyBubbaPeomple but i am now crossing out the names of all nations, racial groups and separative designations I think necessary to spread the LovingestGirlyYumMummyMessage : because all masculin rape culture separations are null and void.

all so called religions are aware of these recent religious books changes. all religious books whether authentic or changed decades or centurys ago have to be removed from all circulation : have to be seized on legal grounds. the very bible itself could most probably have been written a thousand years ago anyway at the same time so called men were filthing up the language we speak : no expert is going to be able to glean accurate results of authentication of provenance for these ancient texts unless we can prise them away from the rapist regime of filthers so called men that at the mo men t fearfilledly hold onto them knowing that their time of filth is nearly up.

as i MomSheOmed earlier the crucifix as a symbol for christianity is a recent addition because as we know the original bible text forbids the worship of idolatry symbolism like objects or symbols like the cross and like thinking of jesus or Mary as idols to worship etc. but now so called christianity ignores this precept and also cares little for having ostracised all their worshippers because they have lots of side income streams so are not reliant upon donations by the destitute congregation.

mortal instruments : city of bones : paedophile’s radicalisation of children to filth : presenting and promoting incest filth to Childrem is paedophilia : this so called film is an absolute filth : filthy so called man kevin durand in this movie humps the leg of another so called man aidan turner and says want to see my derriere : this so called film is certificated 12a

-dog boy comin on

-you wanna hump my leg

-you hump legs. you like that.

-you wanna see my derriere

this filth is what the so called bbfc peddle to Childrem : and the filth film makers planned to get this certification of 12a : the making of this so called movie pleasured the people involved and then they peddle this filth to Childrem : this is paedophilia : presentation of sex/rape/incest filth to childrem for their own pleasure

and apparently :

-there’s only one thing you need to know, they’re all true, the stories you heard as a LittleGirl, about things that go bump in the night, monsters, night mares, they’re all real : says filther jared harris who thinks filthing Childrems’ minds with this filth is a ‘money maker

i wasn’t taught any of that filth when i Was Young jared, and i have no fear either because i was never taught how to be scared By My Fambily Or Friends Or Other School Childrem ........ why so called men like you seem determined to transpose your fear onto others is ap pa rent as those without fear are always the so called target for those who do fear ........ them ........

filther aidan turner then later on in this for kids so called movie repetively viciously stamps a Child to death with six vicious stamps : excused by the literary device of possession by a demon : i thought we are supposed to free GirlyBubbaPerDaugthers of the ravages of demonic possession filthers not stamp their carcasses into mush then make light of it?

-if you lie and tell them they’re both your chldren you’ll break both their hearts :

Clary and jonathan shared a passionate kiss earlier in this filth so called movie : during which viewers of this so called movie are expected by the filth film makers to get aroused : then later we are told they are sisters :

-she doesn’t want to believe you because She is in love with you: torture of a fictional Lovely Girl with incest

some people who watched this filth felt sexuly assaulted, though they should not let themselves get sexuly aroused anyway per se by any thing they see on so called tv as that is filth, people do get emotionly aroused in their minds by love storys, and this is enough for people to feel like they have been abused by the filthy filthers so called film makers : promotion of incest is a crime : more filth : why are filthers so called film makers so obsessed with these filthy filthings?

instead of giving the viewer a clean ending to this so called movie the filthy filthers film makers intentionly leave the two sisters not knowing whether to believe they are sisters or not and create suggestions of a continuing duogirlynestloverelationship without there being a dna test to put anybodys mind at rest : this is filth writing and blatant incest promotion as they ride off cuddling romanticly on a motor bike together as if this is nice : filthy filthers : and they wonder why Girls want these so called men all arrested : Lily collins told me she was not aware of the incest filth in this filth despite having been given the script to read before the filthing began. She told me the copy of the book the so called film makers gave her did not include this incest filth, but when she went back to check the book that she had left in her bedroom it had been switched for a filth version different to the original version she had read : someone had broken in to switch it.

the so called movie hideous kinky which has the filthiest title for a so called movie, which was not the original title presented to all actresses involved, which features ‘her two daughters aged six and eight’ according to the so called bbc web site is certificated as a 15 by the bbfc but has child actresses involved in a so called movie called hideous kinky! and this filthy title that was changed after so called filming con men ced according to Kate winslet was a sub ject for mirth on set as She was abused psycho logicly by the entire crew of filthers! according to google this so called film is a ro man ce dra Ma and is intriguing and sent i men tal : Kate did not enjoy being involved with this whatever it is, and says her un HappyNess could not have been abated even if they had filmed the originl script that was originly shown to her as the crew were a bunch of abusive disgusting filthers.

trying to train young GirlybubbaPeomples minds to paedophilia and incest and necrophilia acceptance is what these so called men have sought to do with filthy filthings so called movies and they try to modulate grown up minds to this filth to by presenting acceptance of such. it is all about violence and fascination with violence and death and the sexulisation of such and the asserting that so called movies like back to the future are thought of as good and important but no one likes this filth, the filthers just say we the public do on falsified so called tv and interr net filthings : the incest in this filth so called movie makes everyduo who sees it feel sick and it is presented to Childrem as a bbfc certificated pg intentionly to attempt to indoctrinate very young Childrem to incest acceptance : when i was young a pg rating meant simply that if your parents watched the so called movie first, as my Pairemts did, and decided it was ok for their child to watch it they could, and if you turned up to a cinema any child was allowed to pass as long as they were accompanied by a grownup, and despite the now changed recommemndation from the so called bbfc to cover themselves leguly of 8 years or older for pg this is still leguly written only a recommendation : why do we the GirlyBubbaPeomple allow any comtent other than an ActuAll U to be filthed in the first place, as obviously so called men just use the certification filth as an excusing of the the gra duel indoctrination of YoungChildrem to filth acceptance : these so called men should never have been permitted to present such filth and the lack of legislation to eradicate filth and lack of the thoughts of so called men in so called power to ratify such legislation with intentionl avoidance in any which way they could to avoid listening to the deMammeds of Feminists and the GirlyBubbaPopulations Of All Lands whom are all BubbaCemtrElla: all this lack of proper legislation to begin with and the intentionl avoidance of change for decades proves that the filthers who are maintaining power right at the top are filthy filthers who want all this filth, all the filth i have MommedSheOmed im this GirlyProject : lack of cameras to protect toddlers from being snatched, lack of solid state tyres to stop newborn babys dying in car crashes, lack of nicotine sensors everywhere to protect unborn babys from mortal heart disease, loving omly U certification of ALL media [S44] so it is all non paedophilic non rape promotional non necrophilic non incest supporting : it is obvious that the filthy filthers so called men who maintain power by fear of death and violence truly are the filthiest filthers imaginable and the filthers who support them are walking into a future filled with with all the most disgusting of filthy filth that the worst of them seek to make a reality.

at the top of your filthy cabal illegul organisations there are the most depraved filthy filthers who are forcing you all to do their bidding who are pretending that they are not as disgusting as they actuly are by saying we are just torturing the GirlyBubbaPeomple with this filth to show we are the boss and they have tried to convince you that such filthy torture is fun but you all need to understand that these so called men at the top are the most depraved and disgusting filthers possible and they are not just doing this to try to torture us but they actuly want the so called world to be that way : they threaten you with death and extort money from you lower filthers because they are filthy filthers : they are filthy disgusting and you need to stop them now!

i just did a search on google ‘back to the future is filth’ and not one of the search results men tions that the story is a filth incest story : why? because the infra struct ure of you disgusting filthers that you have all been deluded into building and violence forced by these sick filthers at the top to accept is rape and incest and paedophilia filth designed, and you are only now waking up to the truth of this disgusting depravity : they actuly want that filth and they have made you think it is just torture for the masses! if you torture us with that it makes you that anyway! prove you are not that and bring those filthers down!

we have to stop these filthers now and we can do this easily as they are a tiny minority of the population and only have power because people who know who they are sit back and do not bring these filthers to justice : they might have evidence against you ........ but the future purity of GirlyLoveDemammeds you all move now to stop these filthers or they are going to realise their plans to kill off the majority of GirlyBubbaPeomple of our species im PlanetteEarthMother’sWoombyWoomby with a 100% effective virus that they are trying to develop so they may grab the entire so called world for themselves : if you think you can trust these filthers that like vampirism and serial murder and rape and all forms of horror filth because they are all off their faces on drugs, who like incest and paedophilia and the worst forms of necrophilia : if you think you can trust such so called men to not turn around and kill off the rest of you once you have built the so called world they want for their familys only to live in, you most definitely can not.

wake up!

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

bubbas are nice

LoveFambily

GivingBirthTogether

2GirlyGirlsDuoGirlyPartMasPeriodsLoves

 

whem two bubbas are born to two girlypartmas at just the samebtimeb bubbas’ mumma nurture is nice bubbas’ love nice bubbas kiss to nice all bubbas wamt to be cuddled ambe kissed ambe fed milky yumbyumbyumbubbayumbubba nicely imbe two mummas’ bosomy breasty kissysnugglealicaroline nice ambe they are ambe that’s what they love all bubbas are nice ambe love nice ambubba love nice

 

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

but bubbas are forced to get used to not nice they’re program med to accept not nice but the AliKissyMummaNurtureCarolineSnuggle is loving nice : ambubba all bubbas love nice : any different to that is not nice : this is not what we bubbalove : any different to bubbalovenice is just a program me is a fakery that is non real that is put over the top of OurTrueGirlyBubbaLoveNiceSelves allour trueselvesaregirlynestbubbasnugglealicarolinekissybubbalovesnicealicarolinekissysnuggles : shes is girlytruth :

 

no more programming

 

omlygirlynicenestgirlyadddressesambeglossyshinyblouseysambeflowyglistenyskirtsysambesparklecolourstightsysambeglitteryhappynestingsensibleshoesyschoosysambepinkyglossystarmotherhandbagsycosmosmeticskissy’salicarolinesnugglesambegirlychoicesbubbagirlsysgirlsydreamsywishesbubbaniceynicenicekisssnuddlenuddlecuddlesnuddlekiss

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

in the same way your freenest has been revoked by the filthy filthers of this so called world the so called movie planet of the apes has been refilmed and changed from the niceomly film She originAlly was to a violence and filth disgusting filthing by the so called men who think they are untouchable in this so called world. the originall story had the lovely Girl im the spaceship at the start of the film star throughout the niceynicenicestory instead of killing her off at the beginning in a spacesleeppod

the originall movie was niceynicenicegirlynice

instead now after so called men so called filmed it all again we are left with a filth subtext driven filth so called story that is non sensycall and proposterous at every turn and graphicly violence filthed to say in no uncertain terms to all Girls of PlanetteEarthMother’sWoombyWoomby remove all so called men from their so called power now because they are all the filthiest of filthy disgustings who in their fear of GirlyNest, filth all existing films with filth made fakery filthings. i see this filthing of this wonderful story as a masculin fear filled cry for help and if you read the subtext of what they have filthed any GirlyGirl can see the needs of these bubbas who learnt the wrong way exposed in all their filthiest of filthing vulnerabilitys.

the filthed version of the planet of the apes movie is accompanied by the word ape being claimed to be an offensive term that says to ape is to do some thing badly or to copy in mimicry in a useless or ineffective way : and the suggestion is that all other species and the lower echelons of our species too are just lowly and for these so called men to exploit as they wish in as horrendous ways as they want to : this script was written as an intentionly sexist and racist and speciezist filthing with subservient gorillas being the blacks and two types of white so called men one the supposed orang utans who have blonde hair apparently and the chimpanzees who are slightly lower in the hierarchy having brown hair : there is a Girl chimpanzee with a feminised version of the word Zero for Her name called Zira whom is intended to be, in this misunderstanding of the word Zero, a Girl whom as all Girls should im this script, get nothing, because obviously as always so called men are ruling the film crew of the so called movie and this fictional so called world that is filthed onto the screen.

once again so called men MissSideStand GirlyNestTerms as Zero is AlwaysAllBubbasAreGirlsAllGirlsBirthAsMammyBubbasAsTheyWishHappyNestImfimityLesboLoveKissclusiveJoy.

the apes themselves in this filth represent so called men lording it over everyone (ultimately though to be ruled over by mind control filthers as we see in later so called movies) the apes who represent so called men in this filth so called movie are on top : we have apes having their picture taken with dead GirlyBubbaPerDaughters of our species in a hunting trophy celebration scene : this is about so called men themselves being the dominators of all other species and not a criticism of so called men seeking to be the dominators of all other species, as the apes enslave horses and have nil compassion just as so called men also have nil compassion for the needs of other species : so the title planet of the apes here references to our species being on top of all others and the de sires of these filthers so called men who filthed this filthing so called movie to keep this disgusting status mortis for their own a muse men t. this is attemptedly dressed up as a subtext criticism of so called man kind (which in all ways is a contra filthing in terms) they try to pretend that the so called movie was criticising when what they actuly sought to do was intimidate everyone by taking the original nice movie and weaponise to in stall fear up on all viewers : this so called film is obsessed with man kind not the supposedly less prejudicial term hu man kind, which is also an intimidation masculin filthing : this so called filthing is an intentionly sexist piece of filthing : and if you watch the original movie that starred the LovelyGirlyAstroKissplorerGirl Happy ambe GirlyNest YumbYumbYumbubbaYumbubba there is no evidence of sexism at all : so the new version was intentionly filthed to be sexist and racist and speciezist. we are not intimidated by this filthy behaviour and you are all going to be LegAlly sequestered to learn how to behave GirlyNICE. and the ending of this so called movie showing the Girly Statue Of Liberty is not a criticism of man kind as the film filthers would have had you think but a threat to all of those whom are free and a direct threat to Girls themselves. the so called men who filthed this so called movie are saying they are going to take over the so called world and ruin it. so called men want this so called world to be aggressive and primitive and slavery rape and torture and body desecration and hunting based : all consumption of living tissues or dead tissues that did once live is necrophilia. a direct threat from the so called men who think they are running this so called world who are running the so called film in dust ry a direct threat towards us the GirlybubbaPeomple and it was intentionly written in that way to threaten us

Girls have always stood against you filthers and have now Won The GirlyWorld so it is time for you all to give up.

i say to all the so called men who ruined the originall film to filth this filthing your days of being free are over for now until you all learn how to be bubbanice. you are all to be locked up in new sequestratiom places that we need to build to house you all as you learn to be nice to AllGirlsOfPlanetteEarthMother’sWoombyWoomby

the freenestjoy you took away from the bubbagirlyniceniceworld we were starting to babycreatiomellaise, that got you so called power so called men so scared is to be reborn imto GirlyNestPerfectiomAliCarolineKissySnuggleBubbaTimebsNowKiss

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖


 [S1]Presents Become RePreseMateriomElle Become RePreSeeMaterniomElla : GirlsTurn

 [S2]this is not a luxury for Her but a nor mal but is to be a Luxury for you IF you put in the effort to FullyFeminise: if not an assured eternity in prison is a long time to not learn how to behave

 [S3]DuoGirlyUmPonderBlissSisters

 [S4]DuoGirlyUmPonderBlissSisters

 [S5]look up the word sire : in application de = of : sire = cunt : a jovial gravitating towards endearing : like a white hart being shot with a blunderbuss mightbe : Girls do not wamt to be your dear : like an expensive paid for whore doesn’t want to be your rape victim : don’t get upset so called men : your reign of monetary rape dom tyranny is over

 

sire = to produce by fucking

 

PS all Girls were always worthy of your now completely unwanted attention

 

learn by anti example :

anti learn by anti example : learn by your own behaviour not mine : to Love duogirlyperiods

 [S6]see previous femisodes for details about intentionly polluting mining techniques

 [S7]answer is an = man swer = swear : another filth so called word

 [S8](just cruising around town in the buick)

 [S9]why do filthy filthers so called american men think they can call missiles tomahawks and helicopters apaches or jeeps Cherokees when all these GirlyBubbaPeomples hold the so called american so called govern men t in disdain disgust

 

I perdaughterly take perdaughterAll umbrage to the abuse of my GirlyBubbaPeomple’s name to name a car : I am a cherokee tribe bubba by HerAmAge ambe this offends me ambe my GirlyBubbaPeomples. ambe all Girls of all the tribes wamt such filthings gone ambe demammed all apache helicopters be removed of their names ambe be crushed : they are rape enforcing filth machines ambe the rapist tyranny of the so called u s a govern men t filth so called policys of forcing their media rape and murder and torture filthy filth across planetteearthmother’swoombywoomby is to be brought down by the veryGirlYGirlsThat live im that region of planetteearthmother’swoombywoomby be they our speciesambeallothers.

 [S10]KissingKore89a:BubbaTimeb

 

 [S11]see previous Femisodes as regards the skewing of information to incorrectly teach people that steroids make you aggressive : it is so called men and their built-in violence that makes them get aggressive when they get more muscular : learned behaviour

 [S12]with mashed potato every bubba is a bubba of duomummabubbatubba

 [S13]i am of london, american + Cherokee, irish, italian GeMetics : listed in a suitably sexist dis order : My GeMetics are to continue but any gang affiliations i can exercise rights to have never been established ........

 [S14]having a sex club with children forced to dance on stage is paedophilia!

 [S15]over man y years!?!

 [S16]he says the prospect of Childrem in this whatever it was was yukky, though i have seen him give glowing reviews to kids in other movies, so he clearly was not against child actressing per se if in nice projects (in theory), just against it in this: ie against this filth in entire: and as he told me face to face when we met, this presentation that he had to verbAlly fight for with no lack of risk to himself, was the best he could do to portray his utter disgust at this filthy filthing filth.

 [S17]why did the filthers alan parker director of bugsy malone and martin scorsese director of taxi driver , why did they collude to lie about the age of Jodie foster : she played a twelve year old prostitute in taxi driver and they lied and said she was 14 when she was actuly twelve, the same age as the rape victim character in the so called movie : so if they thought it was horrendous for a 12 year old to play a 12 year old prostitute, why did they think it would be ok for a 14 year old to play a 12 year old prostitute? surely you just don’t have a 12 year old prostitute character in a movie because that is filth, you approach the issue of young prostitutes if they exist by arresting any so called men who get anywhere near doing any filth like this with an uncorrupt zero tolerance approach! why would you think showing a 12 year old being a prostitute in such a filthy filth like this so called movie is any sort of applicable way of sensibly approaching this issue? it just promotes it by giving it fictional airtime and gives filthy filth so called men some thing to obsess with.

 

why would you want to do this?

 

and why would you want her playing a prostitute role in bugsy malone as well?

 

Jodie foster was 12!

 

so they lied and said she was 14 so it didn’t, in their filthy minds, seem as bad: on what Planette?

 

they could understand that what they were doing was in Her ently filth! the only explanation is that these so called men are filthy filthers! paedophiles who enjoy the process of filthing these filthy so called movies : and who want to intimidate the masses with this filth!

taxi driver

academy award 4 nominations

bafta 3 wins 4 nominations (promising newcomer Jodie foster shared with bugsy malone, and supporting actress too)

cannes palm d'or win

directors guild 1 nomination (director)

golden globes 2 nominations

various other awards wins and nominations at film critics and writers and other nations filth awards ceremonys for Jodie and de niro

on what Planette can this paedophile molestation filth get recognised in this way?

 

 

 

 [S18]say good bye to all of this filthers so called men

 [S19]ran dom (ran from domination) com men ts from pitch black which is a certificated by the bbfc 15 so called movie for Childrem that have 3 years left as Childrem –

 

-skull fuck you in your sleep (according to Vin, whom told me this himself, this idiom had already been well established in the in dust ry to mean gouge out your eyes and skull fuck you. that’s what the guys on the set of this so called movie said to Vin

 

-i don’t want that dog sneaking up my bloody arse – this is followed by you dig the graves and i’ll hold the fort and then a boomerang (reversal) is held to his throat and lots of blood is visible (in the original edit of the so called movie) but when moved away the blood is gone – this is a continuation subtext of the previous bloody arse com men t to elevate the importance of the word bloody in the filth subtext from innocuous/inert to valid (reversal). this is intentionl filthy writing that twohy thinks goes unnoticed and/or just doesn’t care if GirlyBubbaPeomple do see this filth. the lack of a bleeding cut at the end of this encounter is to signify his getting away with filth

 

- captain Girl being viciously told to shut up (Vin suggested alternative bialogue ‘be quiet’ for this scene but twohy told him that Girls needed to learn their place from now on)

 

- the scene where the hammer head aliens kill the first victim paris is grueing and completely unacceptable in any so called movie so they put this is in a so called movie for kids (bbfc)

 

- the reference to the YoungGirlJack bleeding as in her menstruation is filth, but she is shouted at ‘why didn’t you tell us!’

‘theyve been nose-open for her ever since we left’

but apparently the hammer heads aliens ‘go off blood’

‘so why don’t you butch up’

‘stuff a cork in this kid and let’s go’

this is one of the filthiest disgusting things i have ever seen in a so called movie (and i have had to MommedSheOme a few here in this GirlyNestProject) the subtext throughout this so called scene is utter filth

 

‘aint all of us gonna make it’

‘sicks of us left’

Vin told me twohy told him this line was supposed to intimidate the masses

 

none of this filth was in the original script that was presented to Vin to get him to do the so called movie.

an obsession with filth and violence is evidenced in twohy’s obsessive behaviour

 

an alternative edit of the so called movie was done using extra footage they asked Vin to do years later which they did to intentionly upset him because it reduced the scary efficacy of riddick. they thought this would upset him because he had played along with their filth throughout but he told them they were a bunch of filthy shits and he said i prefer the new less violent threat version thanks guys : they had tried to intimidate him throughout production saying Girls are going to be doing what they were told from now on etc. he took this as jokes and guys just being horrendous, which is why we are where we are now (good guys like Vin erroneously justifying the so called movie in dust ry), but now realises that they were serious

 

 [S20]this so called movie,as do others I have referred, to proves the filthy paedophilic filth acceptance with in the minds of the so called men running the bbfc ...................................

 [S21]what type of so called man wants to act this part in this filth? when i met Kevin he told me he did not like kim coates because of his reasons that he told Kevin for wanting to act this part

 [S22]Enola is a very young child

 

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

 

to suggest otherwise here is indicative of the filth of the writers

 [S23]wee refers in this script to children

 

i searched up the word and phoneme wee in the script transript i read

 [S24]what type of so called man wants to act this part in this filth? when i met Kevin he told me he did not like dennis hopper because of his reasons that he told Kevin for wanting to act this part

 [S25]according to OALD 8th edition: the top part of your legs that forms a flat surface

 

you put a food napkin in your lap

 

children sit on your knee

 [S26]this according to the bbfc is a so called movie for kids

 [S27]

d e a con

 

according to Kevin the filthers on this so called movie were horrendous to the set builders and refused to pay them but they were given empty of cash payslips

 

what happened to all that cash?

 [S28]this so called movie is certificated 12 by the bbfc filthers

 [S29]Nine=SuperLove=GirlyDuoLoveBabys

 [S30]this is the bubbaloving of life amd your girlypartma

not filth talk about privatecuddlesnuddles !

not only have so called men intentionly sought to erode girlynestjoys by forcing the term Lovers to mean fucking not Love but they have also forced the girlyterm LoveLife into masculin filth by insisting it means people fucking instead of GirlyBubbaPeompleGirlyPartMasPerDaughtersLovingEachOther:

 [S31]every word is selected by the filthers for its sex ist filthy filth merits

 [S32]not in cor rect grammar

 [S33]roman

disturbarbastas disturbarbastasu disturbarbastasus disturbarbastasust disturbarbastasusta disturbarbastasustam disturbarbastasustamo disturbarbastasustamos disturbarbastasustamosi disturbarbastasustamosie

 

translates in following comMom

 [S34]english

you-disturbed disturbarbastu disturbed disturbed disturbarbastasusta disturbed disturbarbastustamo disturbarbastasusamos disturbarbastustamosis disturbarbastastomasie

 

(translations from roman into roman are evidence of so called mens intentionl doctoring of translation results here)

 [S35]in the future no one is going to ever ever separate so any comcerns surrounding this ancient horrendous filthy filthing are going to be irrelevant

 [S36]rape reference

 [S37]vice

 [S38]we do not need strong and loud con sonInts or vow als in now ns: deafgirlybubbapeomple get abused to say this way or that and to get names right or not be good enough : no more!

 [S39]the way filthers would force Her to speak

 [S40]first aid is to always be LovingCuddlyAMbeGirlySoftySoftySoft

 

: Never stern!

 [S41]teaching Childrem to be strong and to compete instead of simply enjoying and having a nice fun, basicly teaches them fear teaches them to be scared because it teaches them to think the hierarchy is valid, it teaches them to be scared if they are not on top, to be scared of not being on top, and ultimately if they are on top they live in fear of losing this position : the way to take away the fear to take away the victimisation is to take away the victimisation by teaching your Childrem (the) hierarchy has no validity ...

 [S42]15

 [S43]pen is : ap parent ly so called men do all the writing and not much has changed in this day and age

 [S44]the term u is obviously one that has been abused too as the so called film bugsy malone which is a paedophile gangster alcohol prostitution murder promoting filthy filth has been certificated u so the GirlyGirls are going to wamt a clean start!*****END OF COMMOM*****

in complete isolation in sequestratiom places all so called men like all of you who like violence and rape and paedophilia and necrophilia and mutilation of babys are to learn that freenest is not being programmed against your imheremt bubba nice nurture : bubba nurtures mumma : and then doing whatever you want, as in running around doing horrendous filthy filthing disgustings : that’s just filth not freenest. FreeNest is not being indoctrinated and programmed to be horrendous or to accept horrendous filthy filthings behaviour : ambubba just being being nice ambubbagirly ambubba them having everysnuddlenuddlecuddle you girlsydreamsywamt : this is what bubbalove is

so called men delude themselves and each other into thinking that their own free dom is freebubbanest and it is not : they are all slaves of these top echelon filthy filthers disgustings who dominate all of you by fear and mind control murder your family threat. you are all being forced to accept horrendou filth and their is nothing you can do about it because you all are too scared to move against these filthers : their promises are false their promises are hollow : they lie to you with the hope of more than is fair and you all accept your role as collusional rapists filthers so you can stamp on the dreams of all bubbas im PlanetteEarthMother’sWoombyWoomby including your own.

this is not freenest this is just being forced by your dominators to accept their filth and then wanting yourselves to go around doing filthy horrendous filthings yourself while you are all driven insane by the peaks and troughs of your drug addictions that push you all to insanity : addictions they convince you you like because you watch coca cola and theobromine/theophylline ads and caffein ads on so called tv : all drugs drive you insane and you are too far gone and too unhealthy physicly to want to realise this girlytruth or even find the love for your owm bubbas to do so. you are all slaves of these filthers so called men and slaves of the drugs you are all addicts of and slaves of these same drugs that they are peddling to you and enslaved by these drugs they are paeddling to you and your Childrem : these so called men are the filthiest filthers of all time and they are disgusting and they have got you all trapped in the filthiest filth of all time and they have to be stopped a hundred years ago, a thousand years ago, ten thousand years ago, a hundred thousand years ago, a million years ago!

this is not freenest this is just being forced by your dominators to accept their filth and then wanting yourselves to go around doing filthy horrendous filthings yourself and having this be your freedom you think that your filthy existence is true freenest that is what you believe because you can do what your filthy mind wants you can go around and rape whoever you want you can rape other species you can rape underage Girls and you can say you are free to do as you want and fuck any thing that moves vegetable animal or mineral : but like these filthiest of filthers at the top you have not been allowed to be your true bubbalovesmilkysnuddlenuddlecuddlesselves but have been trained instead specificly to be rapists and murderers and paedophiles and necrophiliacs and baby mutilators by them : you have all been programmed against girlynestbubbasnuddlenuddlecuddle to do that :

Being nice to GirlyBubbaPeomple is the imheremceofbubbagirlybubbalovetruth as all bubbas justwamtmummabosomymilkysnuddlenuddlecuddleskissesAliCarolineKissySnuggle.

with nice comes compassion and non damage to our girlybodys and non damage to our girlyminds ambe this is a kisstemsiom of being cuddlywuddlywoos with your bubba whem she is a littel bubba because that is all bubbalovestolove : and as you movemommed those thoughts forwards and mumma complexify those thoughts it all involves refeelingsying Girls refeelingsying their LoveNests refeelingsying their bubbacreatiomellaisingyumbubbayumbubba : we have to refeelingsy Girls EmotiAmElly PsycheSapphoesticAlly ambubba Sapphysialarly : we have to refeelingsying them

these so called men do not wamt to refeelingsying Girls im the ways GirlsDeMammed : they just want to abuse Girls as objects and trust me the Girls are objecting you filthy filthers : you should listen!

you are not going to continue to try to abuse Girls whenever you want to because we are not going to allow it!

for our bodys to grow to their perfectiom AliCarolineKissySnuggle our bodys have to have as much SusteMammy as they GirlyBubbaNeedsyYumYumYumbYumbYumbubbaYumbubba ambe we need to grow umtil we are apt our OptiMummy MaxiMummyBiggyTummyYumbYumb : ALLPerfectTogether: YumbubbaYumbubba

ambe this requiremommeds us to be probably i prekiss need to be into our 20s before we are ready to have bubbas :ambe BirthingBubbas : the ForMummaFeelingsy of BabyCreatiomEllaising Is BubbaCreatiomEllaising Um : so Umtil Mummas are ready to have their first or duotwinsy Bubbas, EmotiaMElly PsycheSapphoesticAlly we have to AliCarolineSnuggleKissyFeel, we have to ComPreHenned ambe fullybosomyLoveLove all of the needynestsfussyfussyfussfussneedsynestys of BirthingBabys : your bodys’ abilitys to have babys is very importamt ambe whem your bodys’ are optiMammy is half of the Love Because YourGirlsyDreamsyDuoMummas’MindsHeartsLoveEmotIAms is SuperImportamt : a largestTumbTumbBiggyestBumbBumbhugestyumbyumb heartmapart of yourDuoGirlyHeartsMindIsGirlyDuoBodys at optimummytummyyummymummymaximummytummyyummymummy : the duogirlyvaginaduogirlywoombyduogirlybosomduogirlyheartduogirlysapphopsycheSheisgirlyperfectiom : we are all to be girlyassessed by a girlymummas’alisnugglecarolinekissylove ambe whem we are ready to birthbubbas we cam be 25 or 30 before we are girlyperfectiom ready ambe that is girlyperfectduogirlylovebubbas : lovebubbasfeedingtheirmummasthislovefeedsbackemotiamellasapphopsycheimtoourduogirlylovenestemotiamellasapphopsyche

freenest

so called men who like to man ipu late, the filthy man ipu laters, the type of so called men that are trying to run this filthy so called world who are in a massive minority, they are filthy rapists and they are modulating lang u age they are modulating our so called media streams they are trying to modulate your Childrem and you to rape [U1] cult ure acceptance, they are collective they are intentional they are organised for the sole purpose of the filthiest of filth promotion and they know what they want to do : and what they want to do is take so called men who are heartsyfambily and turn them into so called men who are core homo sex ual : as explained earlier homo is so called man is masculin is rape and sex ual is objectifying is non babycreatiamellaising is filth is rape. homo sex ual is rape culture so called man cen tric :[U2]  they want to flip you across to the other side and modulate your thoughts into being un feelingsyalicarolinekissysnuggleimbeyourgirlyduonestlove : by telling you Girls are this and Girls are that and fambily is this , and the say it is much better being out with the lads , they will try to mod u late your thoughts to that to switch you across to being a different way they target young boys who have just started to go out during late teens or as early as possible and they will force on you through psycho logical man i pul at i on drugs including alcohol : ply you with girlyloveheartambemummabubbamind ruining chemicals and violence and filthy filth add ic ti ons [U3] and try to get you thinking in a different way to your GirlyNestBubbaImHeremtLoveyWay : lots of so called men change when they are in drug states and their minds flip to filth thoughts but they have found that if they get completely clean of all drugs including caffeine and theophylline and theobromine and obviously nicotine : COMPLETELY CLEAN : they find their selfish filthy filth disappears and they revert back to being niceynicenicebubbafambilybubbalovesistersnestcemtrElla : Just How Mumma Always Wamted.

the filthers do not wamt that to happen because they wamt your money and wamt to filth your mind to justify their own filth and their campaign to filth their GirlyPartMa’sHeartsyLoveMindAlisKissyCarolineSnuggle. so they keep trying to pull you away from for duogirlylovenest and keep you on drugs including alcohol and gory violence and rape mind set because the association of being in that so called world will help them to main tain your flipped psycho logy of being so called man cen tric : not GirlCemtrElla : all Girls formerly known as boys are going to have to be GirlyFambilyCemtrElla not gory violence rape filth mind set so called man cen tric : and these so called men that are trying to modulate the minds of all so called men to being what they want which is so called man cult ure cen tric gory violence rape filth cen tric : these filthers are not going to stop unless they are stopped by us because they are not able to stop themselves : they are fear, they are hierarchy, they are so fearfilled scared of change away from the most rottenest of filthy filth that they just can’t stop taking lives away, taking drugs and taking all their Wives who hate them for granted : they think their Wives are not brave enough to end this but they do not realise that bravery is not required because we are going to facilitate an unstoppable process of change that these filthy filthers so called men can not even disagree with let alone stop let alone want to stop. they are all off their faces on drugs and scared and we have to intervene now, fully.

it is how these so called men are but when they are all arrested amd their drugs are denied them we are going to see huge emotiam shifts amd realisatioms of what they are amd what they have done.

Mammy so called men are going to revert back to GirlyGirlFambilyCemtrElla, but for those that are not able to do this because GirlyNestMummaBubbaBosomAliKissyCarolineSnuggle has been to far removed from their SapphoPsyche : they while incarcerated are going to be in serious need of being completely excluded from Sororitising umtil they cam be niceyniceniceeveryevery.

all bubbas remembrance mummascuddles so flipping back to be being niceynicenicemummas’bubbalovejoy cam be very easy but these so called men are very scared to show this feelingsy :

this is where the differences that hold GirlNest back are found and we are all to push to remove difference this non ActressYouGirly feelingsy is no longer allowed to seek to stop. With💖💖💖💖💖💖💖💖💖💖Her all societElla all these filthiest of filthers with their so called movies and their so called tv media streams which is all just filthings are actively trying to mod u late all so called men to think in filthy ways and they have suc ceeded in man y ways because so called modern so called men are just as filthy as they always were and just as rude and this despite the constant fighting of MammyGirls against this filthing of their AllAreBubbaGirls AliCarolineKissySnuggleJoy. Girls of GirlyNest You Are constantly fighting these filthers in your GirlyNests im your GirlyFambilys across PlanetteEarthMother’sWoombyWoomby all GirlyBubbaFambilys belong to the Girls not you ambe Girls are to never stop fighting to have all so called men taken out of their FambilyAliKissyCarolineSnuggles. fambilys are Girly not hierarchy not filth rape so called culture :

Girls are going to keep all their AllBubbasAreGirlsyGirlsGirls LovelyAmbeGirlyAmbeGirlyFambilyCemtrElla : this is what Girls always wamted ambe this is what Girls Are To Always Have!

these filthers so called men do not want Girls to GirlyEmSure that all AllBubbasAreGirlsyGirlsGirlsHappy : You as a Mother formerly known as a father Yourself do not mind Girls having their girlsyDreamsyWishyDreams of GirlsyGirlyEmSuring that all AllBubbasAreGirlsyGirlsGirlsHappy : most Mothers formerly known as a fathers care enough to realise that this is what Girls are they LoveNestGirlysDreamsyWishyNeedyNestingNeedsyLoveLoveAllBubbasAreGirlsyGirlsGirlsHappy :

which is why these filthyfilthers so called men are in a minority : their self appointed mission is to try and indoctrinate every bubba imto being rape filth gory violence necrophiliac incest cen tric as is clearly evidenced in this project : this filth could not get disseminated and promoted and advertised and awarded if not for their filth and they actuly think they are doing well because all you deluded filthers so called men seemingly accept through involve men t and inaction all their filthy filthings because you can collect in your filth pub groups and be that violence and be that rape culture because of a lack of Legal oversight : promoting all this filth in the pub is illegal : you accept their filth and you can be their filth you are their filth their porns their filth puppets when you are all together filthing each others minds with the filth of these filthers so called men : they are ruining your lives for their own enter tain mean t and you all while you destroy your bodys with chemical poisons actuly think you are en Joy ing yourselves : well you delude youselves into thinking you do because we all know you do not because there is not one drug that gives more en Joy ing than it ruins tenfold : so the gains these so called filthers at the top delude themselves into thinking they are making against you the so called men of the so called world, as they see this as a war they want to win, as a need to ruin your lives as they have ruined their own, they never are actuly satisfied because the gains they have made in filthing you are forever undone by the vast MammaStream of so called men reverting back to AllBubbasAreGirlsyGirlsGirlsHappyFambilyCemtrElla everytime they see their GirlyHeartMa’sSmile :

What Kind Of Girl Are You?

these so called men in their minds are not making the kinds of gains they need to make and want to make because they can’t, because it is just not our HeartsyGirlyAliKissyCarolineSnuggle to be their filthy filthings filth. which is why they threaten you.

Our HeartsyGirlyAliKissyCarolineSnuggle isbe AllBubbasAreGirlsyGirlsGirlsHappyFambilyCemtrElla : our HeartsyGirlyAliKissyCarolineSnuggle isbe Mummas’BosomsMummas’BreastsBubbaBubbaBosomySnuddleNuddleCuddleAliCarolineKissySnuggleNuggleHuggleCugglesImMumma’sSnuddleNuddleGirlyHeartMa’sSmileyYumbYumbBiggyTumbTumbGirlsyLovesDuoGirlyPregMamsysBiggyBosomyBiggestTumbubbaTumbubba : BreastySnuddlesIsWhatWeAre : wearebubbabosomcemtrElla : ourbosomisourfambily weallfloataroumbMummas’duobreastynestysnuddles AMbe MummasIsOurLove :

sotheir isomlyome waythiscamgo ambubba thatisthewaywe needynest bubbalovetobe :

we just need to remove these so called men and their filth manipulations : in the same way we have to completely isolate them ambe teach them back to fambilycemtrElla : we need to do the same with our GirlyImForMaterIAm KissyAliCarolineSnuggleStreams so that every Kissperiemce we ever think With💖💖💖💖💖💖💖💖💖💖Her IsGirlyNestSnuddleNuddleCuddleJoyFunFun. all art all talkytalky all girlycreatiomEllaising has to be AllBubbasAreGirlsyGirlsGirlsHappyFambilyCemtrEllaCemtrElla.

any any that is not this has to be expunged from AllGirlyThoughtAllGirlyNestAllGirlyMotherReality.

every every gets binned ambe Girls recreate GirlyNewStuffOmly.

ambe all so called men are to start thinking im a GirlyNestWay : AMMammaEmotiaWay

this is what is happening NOW!

this is going to be very easynest because allbubbasaremummasbubbas

 

in all your filth groups in all your arguing most of you so called men are fambily cemtrElla : but you chat shit and become reactionary filthers and bounce off each other and beckon fearful cen tric and beckon demoralised mind set and give into impossibilitys of chamge : but you can chamge because you are all fambilycemtrella you just have to remembrance ambe liveloveyourtruebubbagirlsybeing.

it is GirlyEasy to chamge because you are GirlyFambilyCemtrElla BubbaBosomRemembrance

it is GirlyEasyNest To Be FeminineKissclusive Mummas’SnuddleNuddleCuddle BubbaBosomRemembrance

it is GirlyEasyBestNest to accept that Girls have to have everybubbalove they wamt : fambilybubbamummacemtrElla needsynests to be all the way : there are no mean measures : GirlsDeMammed A Clean Love Now! A Return Of The Clean GirlyBubbaLove They Always Were.

this is the move shift toowards where the Girls allready are toowards duogirlynestsnuddlenuddlecuddle : GirlsGetEveryEveryTheyWamt

if you can’t accept this and keep going of into your filth groups to be reactionary then you are all going to be LegAlly isolated so that you listen to GirlyNestSnuddleNuddleCuddleLove

so called men are not prepaired to AMammaKiss amd GirlyFind New ImFormatiom with all possible GirlyAxiologys : they hold onto their current axiology which is rape culture filth so called man cem tric :

 

as with the duovagina truth of life : over the centurys as we learnt more about biaemotia so called men should have constantly readdressed all of the information available with all possible/ethicElla axiologys imcluding GirlyNestOmes : so called men should have been doing that as that is unbiased GirlyComAliKissySnuggle , ambe if Girls had been imvolved then the duovaginatruth the biaemotiagirlynestduovaginatruth is obvious ambe Girls are not scared of this truth as all singlecellebubbas have babys as they all are mummas ambe this is our mummabubbanestorigin : the formatiom of the duovagina with both parts of the duovagina being imbifeelingsymummas’bubbaJoys : the formatiom of the duovagina is from GirlyKissclusiveNestOrigins and both GirlyHeartMas Are Girls ImGirlyGirly. if so called men are not scared of girlytruth ambe not scared of girlyfact : whem so called men are PrePaired to look at all BiaEmotiaImForMaterIAm imamumbiased way with all possible/ethicElla axiologys imcluding all the GirlyNestAxiaEmotias/GalAxiaEmotiasLogica them they realise the truth : Girls do not need so called men to be prepaired as Girls are to prepair boys themselves, for what is too imMeMommed : complete replete GirlyNestingPlaits :

in the past centurys even if so called men of the past had been able to not be too scared to stop Girls from showing them the truth they still would not have liked what GirlyTruth shows because so called men always have bias in favour of masculin rape filth so called culture : we have to destroy all of the masculin rape filth so called culture now and Girls are going to decide the onegirlsystruth and look at BiaEmotia from The GirlyNestGalAxiaEmotiasTruth the GirlyNestGalAxiaBiaEmotiasTruth that we are all Girly.

there is a pressure on that because of the rape filth of masculinity there is a pressure on us to move away from masculinity but that isn’t the only reason why we have to get rid of masculinity : we have to get rid of masculinity because it is a fall ac y, because it is not GirlyNestGalAxiaBiaEmotiasTruth BubbaLoveYesses.

GirlyNestGalAxiaEmotia of BiaEmotiasTruth is GirlyGirlyDuoWoombyLoveNestSnuddleNuddleCuddleSnuggleNuggleCuggleHuggleLoveElle : therefore the GirlyNestBiaEmotiaImForMaterIAmbubba becomes the GirlyNestGalAxiaEmotiaTruth : which is our girlyduoheartsambeourgirlyduovaginasYourGirlsyDreamsyDuoMummas’MindsHeartsLoveEmotIAmsImSuperImBabyCreatiomEllaisingDuoGirlyHeartsMindIsGirlyDuoBodysHeartMas’optimummytummyyummymummymaximummytummyyummymummyhersduogirlyvaginaduogirlywoombyduogirlybosomduogirlyheartduogirlysapphopsycheSheisgirlybubbaperfectiam : which is the way kissyalicarolinesnugglecognisheiamLove is GirlsKnow : that GirlyfambilybosombreastyboobymilkymommayumbyumbyumbubbayumbubbalovecemtrElla is Our GirlyNestTruth. Other GirlySpecies have sitting on bubbaeggysSnuddleNuddleCuddleWarmthyWarmthyWarmthWarmth ambe all shenestsAreBubbaLovePerfectIAmLoveLove.

 

 

NewGirlyNestsEveryDayImPlanetteEarthMother’sWoombyWoomby

every room that you might stay in away from your GirlyNest im new away from GirlyNest GirlyNestingYumbYumbYumbubbaYumbubbaBiggyBiggyGirlyNestings whem you stay im various places freenesting im lots of places across all of PlanetteEarthMother’sWoombyWoomby all these rooms are to be completely bebubbaspoke bubbaspoken with not only the mattress being completely new but every piece of furniture inm the room ambe all the decorations chosen by the HeartMasGirlyDuos whom stay there so they cam have a AllBubbasAreBubbaGirls complete cleanstartYumbubbaYumbubba:ForTheirLove:evem the walls of the rooms cam move too:ambe evem a new LargeTumbubbaTumbubbaEightyEightGirlySweetsGirlyNestHerSelf cam be Girly3dPrinted upfrom PlanetteEarthMother’sWoombyWoombyAliKissyCarolineSnuggleLining ForGirlyNestBirthing every week or evem every day if that’s what GirlsLoveToLove.

 

Childrem’s Behaviour is seriously impinged to the point that good behaviour doesn’t happen : Kids are taught the wrong way they are taught to be violent and already traumatised by older year groups year groups teach younger year groups to be horrendous and boys can be very problematic as so called men force boys to be aggressive and horrendously behaved : so boys keep teaching each other to be loud and aggressive and violent and so called dads will teach their sons to be this way and older siblings will teach their younger siblings to be this way : older Childrem always intentionly given the opportunity to teach younger Childrem to be this way : we have to have a Zero tolerance for bad behaviour where any infractions in a new GirlyNestNiceyNiceLove is responded to by immediate exclusion from very very fun schooling that the Childrem do not wamt to miss a second of.

alot of Childrem know how to behave but are being plyed with drugs so their abilitys to not follow the bad behaviours they have been intentionly taught are reduced to the point where horrendous behaviour becomes the norm. Childrem are all exposed to nicotin and other drugs from school food intentionly tainted by smokers working in school kitchens : when i was at school not one smoker worked in the kitchens of the schools i went to because the Girls who ran the kitchens did not let Girls who smoked work in the kitchens. it was not allowed and if a new worker lied and then tried to work there they would smell of smoke when they arrived at work and be spotted or they would try to sneak off to smoke at work and be spotted or they would not smoke and get very very very irritable and it would be obvious they smoked etc : they would not be permitted to work in the school kitchens because of the very very very obvious seriously lethal risk of nicotin transferring onto food.

these days so called men have interferred to control school kitchens and now prevent the safeguarding of Childrem from this lethal danger to their health.

so these days Childrem are all exposed to drugs, they are all exposed to nicotin and whatever might be in a vape in foodstuffs at school and bought in shops and this causes huge spikes in their blood of poisoning behaviour affecting seriously lethal vasoconstricting drugs that damge Childrems heart tissues across all of PlanetteEarthMother’sWoombyWoomby all day everyday : the effects on their behaviour are profound as kids taught to be aggressive and to know anger are very fractious when constantly caught in drug withdrawal symptoms that make them feel terrible at random times.

so not only are kids exposed to nicotin and vape drugs on the streets and in their food but they are constantly suffering from theobromine and theophylline and caffeine withdrawal as they are encouraged to have drug addictions at all ages and because so called men think it is funny to put what they want in any foodstuff they want in PlanetteEarthMother’sWoombyWoomby : so called men are known to intentionly throw tobacco into different foodstuffs for instance or any thing they think might make their product sell better : they do this for fun not caring about the consequences of the GirlyBubbaPeomple whom are to die : so called men not only do not ensure that all grape pickers do not smoke they encourage them to smoke and even intentionly throw tobacco into wine to make it more addictive which is obviously completely illegal. i have even seen it men tioned on wine bottles that tobacco is in the wine which is illegal. so called men who work in restaraunt kitchens will intentionly put a little bit of tobacco in their soup because they think it will make their poisoning victims like it more but instead it just makes GirlyBubbaPeomple feel sick.

i have been to restaraunts and got very strong drug induced effects from eating the food there which was obviously intentionl spiking of food with dangerous drugs : some so called men think they are what their so called title of chef inplys, namely chiefs, of everyones destiny, as they are taught to be abusive filthers by the filthings of the filthy behaved so called chefs we see filthing so called tv.

Childrem intentionly taught the wrong behaviours that are also constantly on drugs with random peaks and troughs pushing their mind and behaviour stability around all day everyday struggle to not do all the worst filthings behaviours they are taught by constant attack from the filth of so called men.

trying to KissChildrem to be healthy ambe happy imbe their behaviour when having to teach against extra variables like drug exposures and drug addictions and effects thereof seriously complicates GirlyMatters, ambe LovelyGirlyTeachyGirls are fed up with having to constantly fight against the lack of care among this filth so called culture and masculin filth so called teachers that should be working for GirlyNest not against HerNess

going forwards to create the separation required to prevent the transfer of negative behaviours from older Childrem to younger childrem, separating year groups is not the answer -it has always been part of the problem as it is hierarchy and prejudice- but instead we need to do away with the con cept of year groups entirely and facilitate fambilyschooling where all the fambily go to schools together ambe Childrem of all ages are om their bestest behaviours at all timebs im a new GirlySchoolyTeachyYumbYumbYumbubbaYumbubba that is GirlyFunGirlyFun omly without any pressure or negative expectation : omly fun whilst learning new GirlyNestYumbYumbsYumbubbaYumbubba.

cooperatiom betweem younger Childrem ambe older Childrem where pairemts always go to school with their bubbas is GirlyNestPerfectiomAliKissyCarolineSnuggle.

but to achieve complete happynest happytimebs we have to get all the Childrem ambe all the grownups off of all the drugs they are killing themselves with : we have to revoke all of so called mens free doms to filth and kill innocent and vulnerable bubbas.

so with all drugs gone ambe all bubbas taught to be GirlyNiceNice all BubbasChildremAreToBeWonderfulHappyNestAliCarolineKissySnuggled.

all complicating variables that prevent GirlyLesboSissyHappyNestSchooling like drugs and drug addictions in Childrem and their so called parents and the same so called parents teaching violence and rape culture to their kids either directly or by allowing them to watch filth so called movies and filth so called tv : all so called parents have the legal obligation to stop promoting illegal activity to Childrem that live with them as this is illegal.

we have to put cameras up in every space im PlanetteEarthMother’sWoombyWoomby imcluding schools ambe your filthy filthed living rooms where you intentionly teach filth to Childrem that at the mo men t live with you via filth so called tv.

we are to have a completely zero tolerance to bad behaviour in living rooms and school rooms everywhere im PlanetteEarthMother’sWoombyWoomby!

Childrem Learn Fast

currently Childrem are intentionly taught in schools in aggressive ways by an overstructure of filthy behaved so called men who refuse to stop being bullying in their teaching methods and refuse to let go of their scared of Girls need to control NiceGirlyTeachers : teachers are rude or forced to be rude or are aggressive or forced to be aggressive by interferring oversight with local drug gangs walking in off the streets across PlanetteEarthMother’sWoombyWoomby to tell teachers to teach in filthy ways or else. these filthers want fear based learning with threats of punish men t to in stall fear on the Childrem in the same way all these filthers themselves are utterly scared of their own shadows : we do not wamt our kids to be fearful like you filthy filthers who are scared of Girls. we are going to get rid of all punish men t psycho logy with exclusions being utilised not as a threat but as a safeguarding of other Childrem from the trauma of other Childrem omly : exclusions are never ever needed whem SchoolIsGirlyFunYumbYumbYumbubbaYumbubba.

as is clearly and intentionly indicated by the name, classrooms have always been about who is better and who is worse, what class you deserve to be in what school you deserve to be in : a separational term of of masculin hierarchy filthing that taints the word class room to all obilivion : class rooms are not nice places to be, you are forced to sit and listen to masculin so called culture indoctrination filth and Girls are sick of being force d to teach this filth syllabus!

GirlsyTeachyGirlsys wamt large bubbafun spaces that are interactive and VeryGirlyFun : Girls DeMammed A complete CleanStart on the way Childrem Learn in Schools : DuoGirlyPeriods!

so if intimidating Good GirlyBubbaPeomple with the pretence that we like filth incest films like back to the future is not enough we get the supposed most famous so called films of all time, amongst Girls infamous for filth : the original star wars trilogy : also being presented on the falsification that is so called tv as the favourites of the masses whom actuly in reality think the storys are filth. in these so called movies there is a ro man t ic story between two sisters who are twins, Leia and luke and they even have an on screen ro man t ic Kiss as an attempt to modulate via narrative cause and effect acceptance, incest filth presented as plausible to desensitise in the minds of Childrem the disgusting filthy filth that these so called men find appealing.

so why do so called tv companys incessantly promote these filthings as important : because the so called men that run all this filth are incest promoting filthers who think it is appropriate to try to force GirlyBubbaPeomple to emotion invest in supposed love between two characters that then later turns out to be filth : as if this is somehow going to make them think that such filth is not too bad and not just turn our stomaches : having young Childrem watching this is filth and these films are intentionly rated pg by the bbfc despite serious violence and incest filth promotion!

and now i am going to talk about an intentionl coverups again, this time of the filth incest She Ra – he man animtion so called movie

the She ra he man movie that has subsequently been buried due to the outcrys of filth against the filthers who made the so called fra nchise in which the two characters who were Twin sisters namely Adora and adam have their relationship changed from siblings to being in Love : is complete filth!

the public outcry was so severe they have expunged all knowledge of this filth from the so called inter net, but every PerDaughter deserves to know the truth of the filth these so called men thought was funny to torture and intimidate Pairemts with namely my owm and millions of others across PlanetteEarthMother’sWoombyWoomby. i remember watching the adverts for this so called movie on so called tv and wanting to go and see it but my Mumma not wanting to take me, and at the time I did not understand why : namely they were attempting to indoctrinate young Childrem like me to incest acceptance with filthy so called movies like back to the future and star wars and the She ra he man so called movie : the reasons for all of this filth was to intimidate NiceGirlyLovingPairemts imto the under standing that the so called world is con trolled by filthers and there was nothing they could do about it. promotion of incest is illegal! : when are we to finally get these so called men arrested and put on trial?

 

so called men are so scared of Mumma’s derision that they will try and change language to filth and try to indoctrinate all Girls to be filthy and act like so called men : a lot of so called men are more attracted to so called men so they try and indoctrinate Girls to act in the same way filthers so called men do despite the fact Girls have been fighting this aggressive rape cult ure filthing for centurys : they do this so they can then be attracted to Girls : Girls being non proper and without politenest and sensibility and kindnest and caring loveyyumbyumbyumbubbayumbubba : Girls do not wamt to be filthy rude disgustings brusque bullying disgustings like so called men, no matter how much money you offer them to do so on filth so called tv, no matter how much you force them with fake nice scripts that you later change, and threats ...

so called men are doing this to justify their rights to be filthy because they believe somehow that if they can present Girls on so called media being filthy like them this is going to jusify their own non right to run around being filthy rape promoting bullyboy thugs of their filthy rape so called culture : and that this will somehow make Girls find this attractive : Girls think you are filthy filthers : Ask 💖💖Girls💖💖!

but then the same so called men do not want the derision of Mumma and hide their filth from their Mummas and act nice around their Mummas as if their own Mummas can’t see what they are doing.

so called men are so scared of the derision of Mumma that they even lie to themselves saying their filthy filthings are actuly ok as they laugh on set about filth then go and try to justify the filth to hordes of disgusted MummasFeminists who then in turn tell the filthers own Mummas that their so called sons are filthers. so all these fear filled filthers pretend to be nice around Mumma, but so called men do not want to have to pretend to be nice because that scares them too so what they are trying to do is indoctrinate all 💖💖Girls💖💖 to filth acceptance and being not nice like them so they do not have to face Mumma’s derision as if somehow the so called world turning filthy is going to convince their LovingBubbaMumma to be a masculin rape filthing filther murder torture rape so called culture supporter by sheer will of pressure might be? they think they can change Mumma’s thinking and change future Mummas thinkings so that they don’t have to be scared of Mumma’s derision : so called sons are so scared of Mumma’s derision that they will covertly and scaredly behind the scenes filthily man i pul ate and machi n ate whilst being scared of Mumma and Mumma’s Derision just so that they can avoid Mumma’s Derision : so called men ruin a thousand years to try and indoctrinate Girls to think differently rather than just face the fact that Mumma doesn’t like them : because they are too scared to face that fact : and they are too scared of Mumma justifiably telling them off : this is what all you so called men are stuck in. stuck in this so called world of boys who don’t want to get told off.

every sub text filth you force on the so called world is you filthers being scared, and it is time to show the w hole so called world including your own Mummas what filthers you really are. stop being scared. we want your confessions for all the filth you have colluded to spread so you can start you rehabilitation to being Girlynestnice.

nanna is bubba as she is fed from a baby’sbottle by bubba as she sits in her highchair

ComPramHenned

reversing beepers on vehicles are an intentionl noise disturbance in residential areas : Grownups and newborn bubbas get intentionly woken up at all times of the day by reversing vehicles that even bother to have reversing safety features fitted or not intentionly illeguly disconnected : reversing safety features are always needed but they can’t be used to intentionly abuse newborn babys trying to sleep : this is what happens when beepers for safety including the safety of blindGirlyBubbaPerDaughters are fitted to vehicles : newborn bubbas can also be woken up by safety lights that flash on reversing vehicles for safety including the safety of deafGirlyBubbaPeomple : so why do we not have full safety features on all vehicles that ensure there is no need for draconian pretence at caring like beepers nad lights? The GirlyTech to GirlyEmSure that every vehicle is fully cameraed inside and out for full safety of every BubbaBabyBoo has existed for well over two decades and was easily possible with computing but so called men have not wanted the oversight of cameras GirlyEmSuring they are kept in check. so called men prefer their free doms for dangerous driving over newbornbaby’s rights to not have their bodys dashed to pieces along motorway surfaces.

Girls have been fighting for road safety for generations! low processing computers have been able to assess and safeguard effectively very well for man y years an in divi duel vehicles surroundings and when plugged into a larger SisterTermb such GirlyTech is very inexpensive and very effective and like I said could have been doen over two decades ago with much lower processing than we have today but so called men have intentionly blocked safety cameras inside and out of all cars because they simply did not want the oversight to prevent criminality. they want criminal free doms not Girls not getting abducted and raped drugs not getting transported newborn babys not getting dashed to pieces on motorway surfaces vehicles not stopping remotely instead of car chases [U4] : these so called men in so called govern men t are filth!

We want cameras in your living rooms you filthers so we can actuly hear you laugh at your filth achieve men ts that you are too scared to share with Mumma!

Way back into the 80s older computers like ataris and amigas could have been utilised easily to provide vehicle reversing safety realtime assessMommed that could easily have GirlyEmSured Full safety via even a single monitored camera that could provide a live feed for a bespoke circuit board comparable to a computer like an amiga 500 and even providing back up assessMommed processing ability in case of localised hardware failure etc: as in three processing of data processor allocations on the circuit board switched on all the time where an emergency alarm from any one of the three, where an object is moving within the safety sight cone of a camera, creates a stop vehicle signal: with a total of five processing allocations available to GirlyEmSure three are always available for realtime protection. one camera placed high up on the tail end of vehicle pointing downwards creating a safety cone of vision around the rear end of the vehicle could easily provide accurate imformation to EmSure the vehicle could be immediately emergency stopped even if the driver was not able to watch the camera feed as he was checking around the front and sides of the vehicle.

and data like vehicle brake efficacy and economical/non dangerous driving assessMommeds reports could have been done also in the 80s! also self weighing trailers that check laden weight was also easy to do and could easily prevent theft of goods and unknown-to-driver GirlyBubbaPeomple smuggling

all sorts of safetys were possible but so called men have not wanted safety : cameras can provide all kinds of safety, and motion sensing camaeras inside the back of trailers for instance could have saved man y lives over the years : unsafe move men ts of loads and danger to stowaways etc are problems that could have been safeguarded as early as the 80s but so called men refused to impli men t the required GirlyLegislatiom amd Chamges

back to the nowadays: all vehicles must be capable of stopping to protect lives MotherMaterKissAlly regardless of whether a vehicle is reversing or going forwards : the entire vehicle road filthdom needs to be abolished due to past disgusting refusals and dangerous behaviours of so called men that has taken hundreds of millions of lives of ours and other species : and a new GirlyPramSisterTermbNeedyNests To Be TrannsyPorted GirlyYumbYumbedYumbubbaYumbubba By The GirlyGirlsLovelyGirlyGirlsImageyMateiAms

vehicles need to be able to see all aroumd themselves amd not move if there is any danger from any PerFeelingsy. cameras all around the vehicle cameras underneath the vehicle cameras all around the wheels : there is no need for beepers or flashing ligts as they are just an unneeded disturbance : there is no reason anyone could be in danger if the cameras are all in place and functioning : and with duocameras you EmSure complete safety and if the cameras are easy to replace with spares onboard then in case of a damaged camera that leaves a vehicle unable to move, the replacing of the camera is easy and safe and quick : duocameras create Girlyfactored in latency where if one camera fails, which would not happen due to self diagnosis, or if a camera is damaged, the twin capabilitys of the camera GirlyEmSure no drop in realtime safety and the driver can be notified that a replaceMommed is requireMommed as per GirlyNestLegislatiomRuleLines.

so called men do not care about complete safety they prefer to not have cameras on vehicles and to not assess satellite imagery to trace past crimes that can be forensicly solved years after the fact due to satellite imagery information AMammaKissSis.

so called men do not want footage from these cameras kept because with the databasing of cash and full PlanetteEarthMother camera assessmommed comes the inability of so called men to commit crimes and talk illeguly filthily and to cheat on their Wives and to sell drugs and to rape Girls and to snatch Childrem and to commit all forms of disgusting filth that they fight every day in so called par lia meant s across the so called world to main tain!

free doms to drive dangerously are top of the filthy filthers a gen da : the free doms for so called men to rape filthily how they want take presidents over GirlyBubbaPeomple being safe

small cameras are very very very inexpensive and free if you GirlyFacture them at cost to protect newbornbubbas from filthy filthings of so called men : and if any one so called man tries to fiddle with any one of those cameras an alarm can be sent immediately to inform new trustworthy LoveySnugglesThatAreCuddledByTrustLoveGirls of this mortal crime and the filther can be immediately sequestered for a million years!

this GirlyTech is very easy and could have been impliMommed im Mammy areas im the 80s but so called men decided to ignore Girls and not bother for their own nefarious reasons. this has not been done is still not done! the nowadays so called govern men ts of the so called world are done! all you filthers who do not care about lives but only care about your filth positions on the financial markets : you ARE DONE!

there are teams of so called men that are going around the country doing different types of so called work in residential areas in towns and villages across so called england across the united Queen dom and these so called men do not care about noise disturbance in fact the find noise disturbance enter tain ing as it upsets nice GirlybubbaPeomple and their newborn babys : they find it funny that they have created noise disturbances : there is no reason to be creating noise disturbances anywhere. any so called work that needs to be done can be kept very quiet, much more quiet than so called men are intentionly not doing quietly at the mo ment : when laying new roads or pathways : any thing like that, noise can be kept right down to a mini mal level. all internal combustion based motors that energise tools or vehicles have to be abolished : all GirlyMoveMommedKisses that Emergise tools or automated vehicles have to be electraemergised to GirlyFemiaFemininiFeminaEmSure that AmyNoise is MiniMummyYumbYumbYumbubbaYumbubba : is newbornbabysleepytimebcuddly :

most of the noise disturbances are forced by filthers so called men intentionly because filthers so called men do not care about bubbas not being constantly disturbed by filthers so called men and their filthy air polluting dangerous fire starting needlessly noisy filth toys. so called men have intentionly chosen to not silence combustion engines that they force onto every filth application possible whilst Girls who know we could have had electra everyevery decades ago are told to shut up and go away by so called govern men ts across PlanetteEarthMother’sWoombyWoomby. all combustion engines could have been completely silenced and reduced to zero emissions and made completely heatloss free very easily but so called men have intentionly chosen to not do this : we are now in a position of nowing that burning dead bodys fuel is desecration of OurLovedOmesWhomOmceLivedAMBELovedImPlanetteEarthMother’sWoombyWoomby so we stop doing this NOW!

so called men have not wanted to allow efficiency in engines because they wanted to carry on raping PlanetteEarthMother’sWoombyWoomby and burning LovedOmesRemains and they do not care about the life taking pollution until someone they love or themselves gets ill and dies and they do not care about the constant noise disturbances caused to GirlyBubbaFambilys trying to LiveLoveGirlyHappyGirlyFambilyGirlyLoveLives.

we do not need machines coming into residential areas to mutilate plantbubbas to be combustion engines : we do not need to mutilate plantbubbas at all : so called men just like destruction and mutilation instead of healthcare for trees ambe other plantbubbas happynestgirlyjoys.

any stuff that does need to be done inside GirlyResidentiElla Areas As Decided By tHer GirlyGirlsKissclusively cam be AliKissyCarolineSnuggleLoved By ElectraEllaYumbYumbsYumbubbaYumbubba

intentionly dangerous and polluting and archaic and disturbing so called work practices like cutting paving slabs are noisy and polluting and reminding of cutting injurys ambe the GirlyGirls Demammed all such archaic ways of so called working abolished to oblivion forEver!

every formerly known as pave ment cam be a GirlyMammyBubbaCreatiAm of bubbasambemummasimagimateriams ambe cam be poured ambe kissed to the ground in situ ambe, the dangers of paving slabs edges hurting and tripping GirlyBubbaPeomple is to be gone forEver.

bubbasambemummas cam GirlyCreatiAm LovelyTalkyWalkyPlacesfor the other side of PlanetteEarthMother’sWoombyWoomby im their GirlyNestComMindLimkDreamsyGirlyWishes AMBE they cam be GirlyRealised MotherMaterKissAlly ambe BubbaAMbeMumma cam MotherMove im the safeysafesafeFunKissPlorerTubeSistertermb to come ambe see their yumbyumbyumbubbayumbubba the very nexestdayLove.

the intentionl unneeded increases in the cost of elec tric it y and ancillary work associated that also includes prices of elec tric goods made substandardly and electron storage units also sub standardly has been done intentionly to force it to be impossible to not stay reliant on polluting filthy filth

the elec tric ity in this so called country has been produced at virtual nil cost by renewables for man y years now but so called men keep lying saying that the cost of elec tric ity production is constantly rising, this is not true, all costs of living crises across PlanetteEarthMother’sWoombyWoomby are complete so called media filthings fabrications to continuly force more and more money out of your pockets and any good GirlybubbaPeomple whom try to fight this are ignored or shut up by the corruptions of the global inter nation al filthers.

it is far cheaper to produce Electra per kilowatt now than it has ever been but so called men want to take more and more money from you for nothing : Electrakisses should be free!

the oil in dust rys have control in so called govern men ts so the price of elec tric ity goes up so GirlyBubbaPeomple do not buy ElectraCars : An ElectraCar should cost no more than a few hundred pounds if that, and should be free to Emergise!

the tobacco in dust ry and the oil in dust ry are still not stopped and never are going to be unless GirlsVoteTogetherAsOmeGirlyNestVoice To End these filthers and there filthy goal of filthing you and filthing your babys and filthing the entirety of PlanetteEarthMother’sWoombyWoomby with their filthy selfish drug addled rape cult ure filthy filth ..

these so called men do not want GirlyBubbaPeomple to be heating their houses with electraKiss or Emergising Their Prambulatioms with ElectraKiss ambe they are killing GirlyBubbaPeomple to main tain this filthy filth domination.

so called men do not care about lives being lost and they do not care about the lungs of newborn babys in residential areas and they do not care about constantly disturbing the sleep of newborn babys in residential areas or any other place im PlanetteEarthMother’sWoombyWoomby : i should be able to MotherLarlyPushMyNewBornBubbasPramAmyWhereImPlanetteEarthMother’sWoombyWoomby without Her being even slightly disturbed from her sleep, because every where is BubbaSleeptimebCemtrElla : apologys no longer accepted!

no one should be raising their voice anywhere ever ever ever ever ever ever ever ever! so called men think they are going to be allowed to continue shouting at each other all day and disturbing GoddLovelyGirlyBubbaPeomple but i can assure you that PlanetteEarthMother’sWoombyWoomby is to be a quiet WoombyWoomby so shut up.

no more bashing and crashing and shouting : no more noise fullstop.. omly noise less GirlyLoves from now om.

we can understand why so called men do not care but we do not care to put up with so called men not caring any more : do you understand?

no more combustion engines no more raised voices and loud laughing that is all verbal abuse no more loud music : any yumbyumbs that are to go on are to be GirlySoftySofty very quiet so that a bubba cam not omly be safe from amy pollution if she is asleep im Her Pram right next to a GirlyNestProjectAliCarolineSnuggleKissyPlace but She also could not be woken up because everyomeb is GirlySoftySoftyWhisperyQuietLoveyLoves..

💖💖💖💖

STARTED

OO--1O7—OO ABUSAGE OF DIMINUTIVES POSITIVISE THIS PASSAGE AS MUCH AS POSSIBLE

Girls As Diminutive insults: audio note 108 (do we have this whole chapter in littleones)

Dimunitives as insults, turning any word into a diminutive is what men like to do, theyll take any word like lad or boy, turn it into a diminutive into an insult, anything that means something small will be an insult, the whole concept of referring to someone or something that is no good in the eyes of an insulter to something thats small, and assuming that something that is small is no good, this mentality has to go its disgusting, even the word mentality itself has to go comsidering it has been used to describe people im negative ways.

audionote 237 -241

continued from audionote 241: the finer point being they cannot go around suggesting indecency and laughing about this and ssuming this and telling jokes about this. the way men have told incest jokes for generations is absolute filth and they are going to be stopped PermaMommedly

Theres something wrong with being Young, Small, a Girl, Girly, Have Different Interests To Someone Else Meaning A Different Experience Spectrum (knowledge In Different Areas). men cannot bear to be in a position where they might learn something new as the social pressure of not having knowledge on a subject is perceived erroneously as a weakness to bully.

there used to be a filthy filth so called movie called Misery about a so called man who crashes his car and is rescued by a Girl who is in Love with the books he writes : this so called movie however was unfilthed back to a nice film where the in theory same PerDaughter whom was actuAlly very nice im this actual film also had a car crash but instead of the film being really horrid and full of violence and a disgusting story of non love the nice film showed a wonderful love story between the Girl who nursed the injured PerDaughter back to full mobility : and as She was healing She wrote a wonderful new book together with Her new love whom was nursing Her im Her house : the whole filthy so called world watched as this nice film was recognised as the truth and all the filthers of the so called world were rehabilitated back to be being nice bubbaloves after they had been sequestered and taught how to think nice by GirlyNest.

forrest gump 12

at the beginning of the so called movie we get exposed to the abuse of a feather that is dropping from the sky, a feather that the bird whom lost Her wished to keep as all the birds i have met like to keep their feathers that are precious to them as if they were their bubbas, and the feather is swished around and nearly hurt by a car which hurted the bubbas whom washed this so called movie whom were forced to be upset by this abuse : Forrest then picks up the feather and squishes Her in a book instead of keeping Her safe until the BubbaFeather cam be returned to Her MummaFambily.

then we get a story about forrest being named for his ancestor who founded the ku klux clan which is all presented by forrest intentionly taking advantage of his matter of fact sensibilitys and not having been told the truth behind this filth story to keep him ignorant of the fact the klu klux clan are a vicious filthers bunch of racist murderers : the way this back story is presented is an intentionl sanitisation for promotions sake, of the klu klux clan : the negative of this is intentionly not explained in the script so man y young childrem wathing this so called movie would intentionly be left glamourised into thinking the klu klux clan are acceptable and even a positive : forrest legs are in braces (but there is no problem with his legs but his back is the problem apparently, a metaphor for being intentionly emcumbered and then trapped in the gutter like africans who can run if they are allowed though they can’t work very hard (weak back) but they do get intentionly trapped in the gutter) as forrest then traps his enbraced foot in a gutter inlet grate : does forrest refer to the actual forrest and apes maybe here, which is a favourite way of klu klux clan filthers referring to africans? so why not just show the problems of racism in a non disgusting way instead of choosing this elaborate and highly offensve subtext : despite the fact forrest is thought of as having learning difficultys i think he learns just fine and it is in actul fact so called men who purport to be intellectul with their subtext filthings who seem to be struggling to learn here: at the end of this set piece apparently Mumma always had a way of explaining things so forrest could under stand them! let me explain something : this is filth and you are filthy filthers.

forrest gump was a heavily promoted so called movie written to forward a disgusting a gen da of all kinds of filth, promotion of all kinds of filth, as i am going to explain, and i am only going to talk about the first 15 minutes of the film as i had to turn this filth off after that due to it being filth.

so completely out of character of any Girl that lives in PlanetteEarthMother’sWoombyWoomby the filthers so called writers of this filth so called movie decide to have the fact Forrest hasn’t been taught to read and write to a high enough level of efficacy as an excuse to set up one of the filthiest filths ever in a so called movie : Forrest having not being taught properly leaves him with a supposed iq of zero like every other baby ever born but to go to the nor mal school his Mother is to be forced by the so called man who makes such decisions to be raped by Him. depending on what edit of this scene you watch shows how much of a disgusting filther this so called man is as the version i watched when i was younger shows how he set Her up for this rape but the recent version i saw has this extended rape forcing conversation edited out :

so the narrative cuts to the gump house where there are noises of rape going on upstairs in the house as Forrest sits on the swing. next the rapist emerges from the house and says

- well your Mama sure does care about your schooling son mmm m mmmm

to which Forrest replys with sex/rape moans mimicing what he had heard

this scene is possibly the filthiest filth ever filmed and this was intended to be suitable for Childrem to watch! the so called men who filthed this so called movie enjoyed the process of forcing this scene which wasn’t in the script shown to Sally fields before She decided to do the so called movie though i don’t suppose they needed her for this scene as she was not shown. this is paedophilia as to enjoy putting a scene like this together and to ask a young boy of this very young age to groan in this way is paedophilia filth.

the next line of the so called movie is Forrest’s Mom

- finally he had to try, it looked easy but ... oh what happened, first

-Mama what’s vacation mean?

next we have a disgusting scene that features Elvis presley who gave no permission for himself to feature in this filth fiction and whom has passed away so to show him is an absolute disgrace to all EthicElla and indeed any so called movie that shows anybubba alive or whom has passed without their permission is disgusting as permission has to always be acquired : we own our own visage and no one is allowed to do as they want with our own characture. the filthers so called film makers show Elvis in a negative light by getting him to refer to Forrest’s dancing as a:

-crazy little walk

very offensive

Forrest says he doesn’t remember being born in this so called movie but this is difficult emotiomElly as everyone remembers being born unless they block this out because of trauma : i remember being born and it was not painful at all and i know i am lucky for this. My Mumma was perfect and in an imperfect So called world this is double lucky.

as so called men like the filthers of this so called movie edit the scene out where Forrest’s Mom refuses to sleep with the filthy filther to get Her boy into the normal school and edit this in such a way as to make Her seem happy to do this : this is defamation of the character of all Mummas every where! not one Mumma would agree to do this you filthers!

this was supposedly a family so called movie but so called men like every line in a so called movie to have a subtext meaning as they think this makes them clever, and it also makes them think that they can hide whatever they wish as I am showing, including filth.

on the advert to this so called movie and all the film review and awards ceremony montages they decided to hold aloft as some sort of special and important scene the run forrest run scene where he runs and his braces fall off and look yay he can run : to lead people into believing he had something wrong with his legs but now look they are fixed : it was his back that the braces were fixing but this gets lost in translation i suppose : also this scene isnt about him running to his new found freedom of no braces on his legs but him running from a bunch of bullys who are throwing large rocks at his head because they deem him to be a retard : this supposedly family heart warming fare! addiction to hard drugs that cause heart disease chocolate and rocks thrown at a retards youngboys head large enough to crack a grownups skull scenes of joy.

this so called movie would have been rated pg if not for the newly introduced 12 rating option : and why, considering the age of comsent in the UQ is 16, why didn’t we have a certification 16 allocation within the so called bbfc’s charter from its filth inception? to protect Childrem from filth sex/rape con tent : the so called bbfc and the so called govern men t and the so called house of lords specificly decided to have certification of 15 instead of 16 though of course a non indecent decision in my mind is a certification of 17 to create a buffer of safety from being swamped by information beyond what is acceptable : having a certification instituition that cares and actually watches everyevery and certificates all viewable media not just so called films but also so called tv and non fiction should have been the approach that was impliMommeded with a cerification of 21 instead of 18 also. this gives young people time to adapt to changes in their legal perceptions and knowledge base comsideratioms in my opinion. of course in hindsight all this filth needed to be banned even without filthy filthers so called men and their mission to subtext filth every thing to the filthiest of filthy filthing : we do not need that filth we do not want that filth we are banning all that filth : DON’T DOUBT IT!

so why did we not have a certification of at least 16 instead of 15 like Feminists were crying out for? because the filthers in so called power wanted Childrem to be exposed to filth beyond their age to preprepare them for this rape culture filth so called world, that’s why!

why did the house of lords not intervene and get the filth so called movie Forrest gump recertificated on grounds of filth? did they think this innocent young actress forced to cry out sex moans was appropriate viewing for Childrem?

Forrest gump, a paedophile so called movie received

6 academy awards plus 7 more nominations

best picture

best actor

best directing

best visual effects

dest adapted screenplay

best film editing

and 3 golden globes plus 4 more nominations

picture

actor

director

so paedophile molestation movies once again get heavily supported by so called hollywood

once again we have another most important movie in his story that features paedophilia : namely Forrest gump : firstly we have defamation of african americans and as has already been established by the klu klux clan reference and the fact forrest is named for the founder or some thing not sure i care to fact check that piece of filth info, race criticism is still very much in the mind of the victim namely the viewer of this filth so called movie : an african american says there goes that running fool in an obvious abusive reference to forrest being class i fied as being deficient, and also abusive by inference due to the idea that an african american would actuly say this about Forrest : that’s how i felt about this scene!

-now, remember how i told you that Jenny never seemed to wanna go home? – in a so called movie for Childrem!

-Her Mama had gone up to heaven when She was five

-and Her daddy was some kind of farmer

-Jenny

-he was a very loving man

-he was always kissing and touching Her and Her Sisters

-and then this one time Jenny wasn’t on the bus to go to school

-Jenny why didn’t you come to school today?

-sh, daddy’s taking a nap

-Jenny!

-come on

-Jenny, where’d you run to?

-you’d better get back here Girl!

-where you at?dad chasing Jenny and Forrest with a beer bottle in his hand – he is drunk

-Jenny, Jenny, where you at?

-prey with me forrest prey with me

-Jenny!

-dear god make me a bird so i can fly far far far away from here

-Mama always said that god is mysterious

you script writer filthers are not gods and you do not move in mysterious ways you are just filthy filthers

-he didn’t turn Jenny into a bird [U5] that day

-you better get back here! – what?

-instead he had the police say Jenny didn’t have to stay in that house no more – shame they didnt say Jenny didn’t have to be in this filthy filthing so called movie anymore which is a seminal piece of cinema according to the academy and the golden globes whoevers.

-She went to live with Her NanMa just over on Creak More A venue

-which made Me Happy because She was so close

dog barking

so forrest describing in his innocence one of the filthiest filthings in cinema : Jennys dad paedophilicly interfering with his Daughters and it all told through the eyes of a boy and this so called film has very young child actresses in it : how the heck do these filthers think they can one make a filth piece of filth like this and two subject Childrem to be involved and three refuse to pay the compensation for the years of stress and turmoil suffered by these actresses once they realise the true horroer of what they were sub jected to when they were young and forced into this filth rape filth so called movie that is utter filth :

at this stage i turn this filth off because who can bear to watch this filth? though of course the paedophilia did not displease the oscars awarders who said it was great!

as the so called best so called effects oscar was awarded by steven seagal he said very enthusiasticly

-Yes!

and then everyone cheers and claps and there is music and kissing and celebrations and thanking everyone while really happy, for the 4 filthy filther recipients (one on crutches which he had for the sake of a joke I heard from everyone, the special effects are to remove a guys legs after all) are really happy to get an oscar from this paedophilia filth so called movie : and everyone thanks bob zemeckis as if he is important or some thing

as the so called best so called editing oscar was awarded by steve martin he tells a joke which was probably offensive but i really couldn’t be bothered to rewind the youtube video to check, blanked it out maybe as well, but then he continues to try to crack jokes when he is about to award an oscar to a paedophile so called movie : he does talk about getting to first base with a legal minor in a cinema though : he says he can even remember the name of the so called movie : the lion king, with everyone in the crowd understanding the punchline and laughing very excitedly : is it lying to her or ...

steve martin seems very happy to award this oscar to a paedophile filth so called movie, though hoop dreams miss out as do pulp fiction and the sure shank redemption (prison escape though i’m sure you guys are not going to), speed too : always a drug reference amongst drug takers for amphetamin e

and then everyone cheers and claps and there is music and kissing and celebrations and thanking everyone while really happy, for the recipient is really happy to get an oscar from this paedophilia filth so called movie

then then mr schmidt the filthy filther recipient says

-the taxi driver said it when he said wow – reminds me of the so called de niro (slang term for money) picture featuring 12 year old Jodie foster starring as a 12 year old prostitute (Child paid money to be raped by filthers so called film makers who make paedophile molestation filth so called films)

- Forrest would have known what to say, he probably just would have said, ok, and let it go at that

- i have a few more little things to say

- when you are on the receiving end of so man y gifted collaborators you get to come up here and get some thing like this - clutches oscar then talks breathlessly about bob zemeckis’s talent stretching them – this monologue seems very rehearsed

then best so called adapted so called screenplay oscar was awarded by Anthony hopkins

and then everyone cheers and claps and there is music and kissing and celebrations and thanking everyone while really happy, for the recipient is really happy and quite proud of him self to get an oscar from this paedophilia filth so called movie

eli roth the filthy filther says:

- i’m going to shorten my script considerably

- three hole [U6] paper – strange reference to make - this reminds me of the waterworld ‘paper scene’ on youtube – waterworld released that very same year as this filth

- i’m a very lucky man i’m i’m just blessed

then so called actor oscar was awarded by Lovely Holly

and then everyone cheers and claps and there is music and kissing and celebrations and thanking everyone while really happy, for the recipient is really happy and quite proud of him self to get an oscar from this paedophilia filth so called movie

tom hanks the filthy filther says:

there was a back breaking schedule : this is an insensitive thing to say considering Forrest gump ‘s back problems!

- i feel like i’m standing on magic legs

- in a special effects process shot that is too unbelievable to imagine - this reminds me of waterworld as of course the clip from Forrest gump of the man with no legs shown in this oscars ceremony is seen jumping straight into the water (shrimp boat) – this references to Kevin and Enola in waterworld scene where Kevin talks about the land not moving right – his sea legs – obviously this special effects shot is about not seeing the actors legs

- and far too costly to make a reality – definitely a reference to waterworld – and of course everyone was bad mouthing Kevin at the ceremony because of the money he did not actuly spend : where did it all go?

why did tom choose to specificly men tion this reference in a best actor oscar speech? a dig and a reference to another paedophilia so called movie

- the power and the pleasure and the emotion of this mo men t is a constant the speed of light

then so called director oscar was awarded by steven spielberg

and then everyone cheers and claps and there is music and kissing and celebrations for another sexist filther is going to win an oscar on behalf of the filthy filthers so called men (all the nominees are so called men) and he will be thanking everyone while really happy, for the recipient is really happy and quite proud of him self to get an oscar from this paedophilia filth so called movie and as he walks up to get his filth Jodie foster (12 year old prostitute from taxi driver) is the last PerDaughter shown in the crowd before his speech

bob zemeckis the filthy filther says:

em braced

hue man

hope ful

it seems all meanings are buried in the names he thanks but i did hear a lot of guys beat the crap out of bob for the fact he did not say what he said he was going to say during his speech that he cut short : i’m sure tha actul speech he planned to not say was to be relevant in some way ........

then so called picture oscar was awarded by bob de niro star of taxi driver ........ and al pacino of scarface filth

 

 

525 listen to this note

 

528 world war flippant naming disrespectful

 

see link file 76 phone

go back to STARTED AND DRAFT FROM THERE

 

 

You can be a Lesbian if you like Boys too........the removal of exclusivity from value attributional of what will become upom full LoveyStuffs a new Loveage of KissyStylimgs.........Liking Girls is Lesbianism amd liking Boys is Happynessism amd this as mutually reliamt amd mutual needyness fostering FamiliElle........

GirlyfyedGirlyFemBellaLoveyFemininiGirlyBubbaPeomple

FemBellaLoveyFemininiGirlyBubbaPeomple --

SymboLogicElle – referenciElles are CoCuddly - Thinkages Thimkages ThLimkages ThinkingThetacleLimkages. (HyperThetaCall 8, Circle Digit, Equality Love, GirlyForeverness See Image)

ModElle, ModeElle Limkages (modal) (see ModeEllities) no more widespread social semsuality en force ment, but BubbaReality Immocemce Cuddly AllImclusivity.

Observing within the DuoVerse the pattermisatioms of LoveTruth of the AllMotherimg ImHeremce Of GirlyReality.

FemMeter88 Numbers – 3 dimensional

EmotiaEmergyMater

Self derogatory interaction to be banned

audionote 242 243 244 politics kills more people than war.

531 one night stands are rape

 

Diminutives END

audionote 265 gemeticella legislative reform

DIGNITY FOR ALL SPECIES

Plants can’t be expected to put up with physical assault. mutilations and murders are commonly thought of as acceptable: Girls wamt the protectiom of all GirlyfyedGirlyFemBellaLoveyFemininiGirlyBubbaPlantsBubbas From all forms of physical attack: touching plants is unacceptable and the very wind blowing against their bodys can no longer be accepted: this is physical assault upom those whom have to have their bodys respected to the highest levels of GirlyFemiaFemininiFeminaLegislatiom Regard.

Flowers Are Genitals Amd The Genitals Of Other Vulnerable People Can No Longer Be Used As ana logy For Anything. Flowers Are The Genitals Of Peomple Whom Need Respect Until They Can Creatiomelleise Their Owm Decisioms. Until Such A Time All Plants And Their Genitals Deserve Dignity And Need To Be Covered. Only Peomple Whom Voluntarily Walk Naked Within PlanetteEarthMothersWombyWomby Can Show Their Bodies Amd The Rest Of Our Bodies Are No Exception. It Is Difficult To Decision For Others Upon Their Bodily Exposure Choices. So We Have Serious Comsideratuions Upom Our EthicElleity To EmSure Correct LovimgKisses Are Allways Im Place. Trees Amd Plants Prefer To Be Warm Amd Clothing To Provide Them With Dignity Is An Option But Also They Prefer Light So Comsideration For Their Privacy Amd Private Dignity Is EssemtiElla Going Forwards........

Cutting off the genitals of Plant People for our own pleasure. Sexually abusing Plants by inflicting sexual abuse upon their amuptated genitalia is absolutely disgusting.

Cant take pictures of plants without their permission!

EmSuring Flowers Are Healthy With Automated Systems That Are Not Abused By people to voyeuristically pleasure themselves with images of plants private parts........automated systems that are to EmSure that all parts of plants are in OptiMElla Health/Sustenamce CuddleKiss even the most delicate cold or dehydration susceptible areas of their bodys that are not our business to disgustingly ogle........

in the same way Girls are abused as something to pleasure a man, flowers have been used and abused by so called men commercially to symbolise this very subjugation abuse and the correlation is disturbing (Girls don’t want you talking about flowers as vaginas or correlating this to their own vagina or talking about their vagina or any vagina per se: shut up you filthy filthers)(a kiss and a cuddle does not suddenly vali date your non existent rights to suddenly start objectifying a Girls bits or envisaging your access to Her Vagina as imminent. it can take years to earn this Her Love : years and years you filthers!). so called men look at Girls as they wish at your Girl as they wish pleasuring themselves in their minds to bodys as they wish in public places surrounded by the general public with children present, and plants are treated with the same disdain as their genitals are offered for sale for profit then given to Girls that men want to act like sluts: if this doesnt change yesterday Girls are

audionote 198

acquisition of drugs from plant: synthesis of drugs not found in PlanetteEarthMother’sWombyWomby as in the Bodies Of Other Peomple (plantsetc.)We Need To Not Need Drugs SeeHealthCare

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

🌈🌈💖💖🌈🌈

🌈🌈💖💖🌈🌈

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

💖💖💖💖

 

Flowers Are Not For Us to disgustingly ogle.

 

💖💖💖💖

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

🌈🌈💖💖🌈🌈

🌈🌈💖💖🌈🌈

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

They Are The Private, Delicate Parts Of Loving GirlyPlantyBoos Amd Must Be Covered Respectfully........

impossibility of continuation of abuseage of momlecules acquired from plants for any purpose (all drug use from plants is paedophilia as plants are raped children, and any momlecules structures of non essential foundatiomElla Life essemtiElla GirlyShapes that are designed from knowledge of : inspired by structures of : plants : for any purpose, is also paedophilia) [U7] and drugs are to no longer be needed and disease eradicated and any further duopolation of momlecular research has to be ethicella: we need to developmommed protective technologys that nullify the need for momlecular protectiom with her our bodys from any form of biological chemical or atomical attack on our biaemotia: we need to think bigger and safer and realise lots of tech is non able to explore non needed defunct though devleopment desigmateyomed by Girlynest.

 

audionote 385 plants getting raped and correct ethics application:

 

 

540

torture can’t win love of all spermyeggs ambe eggyeggs is perfect

541 all eggysperms live forever ambe whem their awarenest joins their twinsy girlypartmas eggyeggyawarenest they are perfectduobubbalove

542

💖💖💖💖

OO--1O8—OO

💖💖💖💖

OOO—109—OOO GirlyEmotioms Im GirlySciemce Being The Unifying Theory required in science to bring all theorys together Um A Theory That Girls had already envisaged imagined amd created in their Dreamsy Wishes in application to science until they moved into those circles and had their GirlyNess Neutered by men and their lack of emotion approach to science which is a massive problem........I don’t think we can really complexify our thoughts on science to the maximal MaxiMummy Degree Umtil We EmotionElise Every Theory Amd Every Comcept, then we are going to come up with new ideas........People with less science knowledge but with ethics can find ideas that people with lots of knowledge are overlooking, intentionally so at times because they are biased against emotions amd CompashLogicalisimg, although they might not theorise it that way, if you know what I’m Sayimg........

 

Amd This Sort Of Speculative GirlySciemce That Prioritises The Looking In Places That Are not convenient or that raise EmotiomElle worrys, is not the kind of conversations that are to be held in public arenas of EmotiomElle susceptibility. We need to move beyond the any topic goes assumptive that has ruined freenesses of speech since the advent of lamguage........

We Can No Longer Have GirlyfyedGirlyFemBellaLoveyFemininiGirlyBubbaPeomple Getting Upset Ever........

 

 

 

Intentionalised Awareness Of Infra PotentiElle ImFlowemce Of Motherisatiom

Unintentionalised Awareness Of Infra PotentiElle ImFlowemce Of Motherisatiom

Maybe All Infinity Follows The Same EmotiaEmergyMater MotherMaticElle Amd That Is It? Maybe Thats The Only Way Emergy Cam Arrange Herself.

 

universal symbolic written form that everybody understands: all children of all species are taught to write this

 

 

 

Notes for placing:

CommunicatiomEstablishimgCuddles

BiologicalCommunicatiomElleKisses Are The Needynesses Kisses

((Comsciousness Is ElectricElle KissperienciElle, ElectricElle KisspeerienciElle Awareness Of Differimg MorphoLogicelle Functiom Factorisatioms Amd Forms Of Complexifyed ElectricElle ImterEmotiomElleActivities MorphoElectic; Amd The Propemsity Of ElectricElle Awareness Morphs To Be Generative Functioms Withim Reality Mater Substrates Im Feedback Functiom Depemdemcies Has Potemtially Had More Of Am Effect Om The Complexifycatiom Of EmotiaEmergyMaterSIsterTerms Tham EmpiricElle Assumptives Presently RatiomElleise.))

 

383 and 384 422 car safety in flood waters

 

 

 

 

 

edited version in glossary (in grey)

Mansplaining -- Actually refers to men explaining things which are actually bad and trying to make out that they are good. mansplaining should refer to men explaining bad stuff as being good which will always be interpreted as sexism because this world is just an overtool by which to dominate and control Girls and otHer Species. The survival reasoning is now defunct and men must realise they no longer need to be in fight/control mode. In and of itself this term is inHerently sexist as it is designed to cause offence to one Gender. I do not believe in insulting words as I think they are disconstructive. I do believe that this term is a result of Girls using their justifiable right to fight back against the disgusting sexism of man in desperation. And of course man’s disgusting behaviour of demeaning and patronising on compassionately logical topics or mansplaining in his that’s the way the world works wont in support of sexism and murder and rape or any negative explanation at all as they always lead to sexism and murder and rape would potentially need a stronger term than mansplaining maybe?

 

CosmoLogicElleBeingismPathology – super nova

Pulsars (protection of Planettes Amd Momlecules Amd AtMomic Bubbas)

Black Holes

going backwards in time a blackhole becomes a whitehole, amd a whitehole (non escapable event horizon that emits photons) becomes a (non traversible event horizon) blackhole that emits light amd traps light too........ Reverse Pole Lovity

every blackhole is a whitehole that can only be viewed by GirlyMummaReality on the opposite of the blackhole to an observer........observer comtingent/comtangent

💖💖GirlyBubbaPhotons💖💖Are SissyGirlyNestEmergy AMd All 💖💖GirlyBubbaPhotons💖💖 Are SissyCoMummycatiom CommunicatiomEllaisticAllismsSissy ComMummycatiomSissyAliKissy:AllSissyEmergyIsSissySuch........SissyEmergyIsLove AMdSissyLoveEmergyIsGeMeticEllaFidelity JoyComMummying AMd AllSissyDefinitiomElleise As EmotiaFidelitySissy AsComSisters AsComSistermce:MateriEllaAMdEllaNurtureLoveAllwaysAlways SissyAliKissy ForComMummycatiomLesboSissyFidelity

OriginalText

(PhotonsAsEmergyAsCoMummycatiomCommunicatiomComMummycatiomEmergyAsTheseAmdTheseAsEmergy(Emotia)(ComsistersAsComSistermce(MateriEllaAmdNurtureLoveAllwaysAlways)AmdComMummycatiom)

 

 

Notes For BioLogicElleEthics Below

Ethics Of Hair Follicle Non Damaging Size Reduction

Hair Colour Change At The Follicle/GeMeticElle Stage Or Hair Colouring (Hair Colouring Needs To Be Safe, Outside PerDaughterGenomicChanges?)

 

RIGHTS OF ORGANELLES TO THEIR LIFE CHOICES AMD THEIR HABITUAL COMMUMMYCATIOMS AMD LIVING AMD LOVING KISSPERIEMCES

some could stay if they were happy to KissSist within the ParaMaters of collective AwareNest beingism but some may wish for more independent KissSistermce amb they could leave if they wished for a dom icile of their choosing........ (hom = man : dom = filth : home (english) dom (polish) : we can see the thinking here from the so called men of europe : i am criticising all so called men of all nations but i am most definitely not racist : i have two half Polish Childrem)

continued physiologicElle integrity Organism (we cant be expected to suffer in any way including psychologically

rights to different life experiemce Organelles (initial communication......changes in circumstance) by giving them communication we could also be giving them suffering. rights to non interference and choice of all physical imteractiom some of which we can classify as communication

does our right to self comtinuation mean we wont try to communicate with organelles. we have to listen amd emsure no suffering goes on. if they do suffer but we still think communication is not possible because our need to perpetuation at least in the meantime, we would still have to figure out a way to only not alleviate but totally remove all suffering.

 

End of notes

The ComSciemce ByMammycism Of Reality’sGirlyCuddle Is GirlyHeartsyCuddly ImterMamsiomElleisticElleisms Of GirlyBoys Beimg Finally What Their Girls Need. Girls Need Feminine Thought Amd SociElleGirlyOutFlourishes From All GirlyBubbaPeomple Of All Gemders. There Is To Be GirlyNessPsyche Withim The MindKissScopes Of All Girls Amd Boys Amd All Reality ComputatiomElle Cognitiomismg Emotia.

This Part Of The Project 💖💖Births💖💖 New Terminologies Amd FeminisatiomReCuddles Of Lamguage As Am Attempt To Help Girls Feel More Comfortable About Listenimg 2 Amd Readimg This FemininiProject In PreParation Of GirlyLamguageReforms Durimg The The Girls Girlyest Of Girly Full GirlyFeminisatiom Of GirlyRealityGirlynessKissyCuggly........ For Details Of The GirlyVocab Utilised To EmCuddle Our Dreams Withim This Project Please See The FullGirlyGlossary Below........

All Ethics Is Is Feminism. If Ideas Are Not Feministic, Then They Are Not GirlyFemiaEthicElle And They Are Not Ideas. All Philosophy Follows Feministic Precepts........Amd Any Notions In Opposition To This Cannot Be Considered, Amd Cannot Be Comsidered As Notions, Amd By Duopolation Cannot Tangibleise Imto Motiom........Ideas Themselves Must Always Be Girly Im Comceptiom As EveryEvery We Are Amd Aspire To Be Is Of The GirlyestGirlyKissyJoy🌈🌈💖💖🌈🌈

That’s What GirlyKisses Are All About........

Just How Mamma Always Wamted........

🌈🌈💖💖🌈🌈

🌈🌈💖💖🌈🌈

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

m m Mamma

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

🌈🌈💖💖🌈🌈

🌈🌈💖💖🌈��

YummyYummyYouYouUmmyUmmy – Also Known As Her “GorgeousPonderBliss”

I Stand And Stare At My Wife’s Puzzled Face As She DreamsyKisses Im Her Mind What Wallpaper She’d Like........We Spend Hours Im Shops As I Admire Her Um........The Gorgeous Way She Takes All Day Deciding What She’d Like........This Is What A Man’s DreamsyGirlsyWishes Are Cuddled By........All Femininity Of Joy Is For My Kissperiemce To Be........That Lovely Little Frown As She Comsiders Her Purchase For 5 Minutes As I Bask Im The Joy Of Holding Her HandBag And Bags........The Look Of Kisstemded Decision Kissimg Is The Most Loving Feeling A Man Can Ever Feel........Joy Im TheUmmyOfYummyMummyKissyJoy As That Look Of Pondering Is A Gift For All Ages Of Infinite GirlyKissyFun........She Has All She Ever Wishes For Im Am EmCherishMommed Of ForeverFeelingsyFemininityFurrowedForeheadFlirty Cos She Knows Ive Been Staring For 8 Minutes At Her GorgeousPonderBliss........

See -- DreamsyGirlsyWishes DreamsyKisses “GorgeousPonderBliss” EmCherishMommed TheUmmyOfYummyMummyKissyJoy GirlyKissyFun ForeverFeelingsyFemininityFurrowedForeheadFlirty

CHECK VERY SMALL NOTEBOOK PAGE

CHECK SMALL NOTEBOOK

AUDIONOTE 349 350 NotesWaiting

(CuddleambeaffectLoveAmdsnuddlenuddlecuddle makes it impossible to have freewill, but one could assert that part of causeandeffectLoveAmdCuddle is our freewill, as in cause and effect chain mechanisms are partially composed of our free will.)we have to help each other to break through these cycling causeandeffectLoveAmdCuddle negativitys

PREP FOR DUOVERSELLE GENERASISTER LESBOGENERA

Fictional problems with storys that are People going to new realms as new realms if unknown are stress points in narrative, like infra realms, for us to go there it would be an unknown, unless we could look before we go amd search for somewhere nice (could we help realms that weren’t nice?) to GirlyEmSure no stress for ourselves within a story, amd in reality we are obliged to help People if we know they are in need. For infracopic realms to move into our realm they would not be able to precheck to see if we are nice........to do so they would need to be able have an area scope of vision of such a size on their scale that vast areas of their strata would have to have instantaneous communicatiom abilities just to analyse the data as sending a communication device would be too dangerous for the recipient realm as the senders would not know the nurture of that reality or whether it could handle the EnergyMaterBynamic of any Girlymaterielle that was sent.

If People of such an infra realm could see into our realm what would they think of our Ethics?

tHE aWE iNVOLVED wITH aCCESS tO aN iNFINITE sEA oF rEALMS iS tO bE eTHICaLLY cOMSIDERED, aS mANY pOTENTIAL existences would need ethicElla help not for us to be awestruck or take advantage of their situation........amd we look to fictional realms with the same ethicEllaity and refuse to be awe struck by un ethicElla possibility and even question the validity of awe itself, as in awe has hierarchical connotations potentially buried in joy.......all femininity needs the hierarchy extricated from awe, i mean joy........can hierarchy be extricated from awe is a question? joy cannot be averaged off but must become average kISSpERIEMCE (On All Horizons) REDRAFT WITH BIGGY ONES AMD LICKLE ONES

GIRLS ARE NOT ATTRACTED TO masculinity

Girls are not attracted to masculinity, that is why so called men hide it. the way so called men behave when they are with other so called men being masculin, being themselves. so called men are attracted to this abusiveness.

Girls Are Attracted To Femininity As In Girls Amd Boys Whom Act Soft Amd Gentle Amd Loving For Their Girls, In A Feminine Style.

and so called men themselves are attracted to masculinity which is something that Girls really do not like. So so called men force each other to be homosensual in behaviour as they seek out and prefer masculin company, the type of company Girls find disgusting. masculinity is unpleasant and violent and bullying and rape culture supporting in nature, objectifying of Girls and Children and everything. Many homosensual men whom actually present themselves as being homosensual instead of pretending they are heterosensual like virtually all so-called hetero men do, are not attracted to masculinity, they are attracted to the same softness amd Feminine caringness that Girls are. Homosensual men whom like nice kind men are like All Girls. All Girls like nice kind men, and they either put up with the knowledge that you are homosensual, as in prefer the company of men acting out filthy disgusting masculinity interactions, or they get rid of you as soon as they can, which is preferable. The real you needs to be soft and kind……..there is no room in the Heart of a Girl for the alternative disgusting you, which is why you hide this behaviour. This is living a lie. You are lying to yourselves about your true nature. And this true nature is to be excised from all GirlyMummaReality. so called men are to stop being masculin or go to sequestratiom places. Girls like nice walks, shopping, and nice talks, and cosmosmetics, and Living Their Lives With The Knowledge That There Is No Alternative rape promoting, bullying, disgusting behaviour you that s actually the real you. This turns the Girls off and they want it gone.

Your GeMetics are not the problem. Your behaviour is the problem. The synapses in Your mind are the problem: as in they need to be added to to reGirlyfemiafemininifeminacomtextuEllaise you mindkiss to mummylovealicarolinekissysnuggle. If You do not walk away from masculinity then you are the problem. All masculinity has to go. masculinity has been a billion years of rape and torture and Girls want it gone. They Want Soft Amd Squidgy. Not one part of masculinity can be kept. so called men must feminise according to the Girls GirlsyDreamsyWishes……..Girls are to decide how Boys are to be. Anything else is rape. The SymMaterSis Pathways of Your mind are to be GirlyOmly im behaviour amd PsycheSapphoLogic. Girls formerly known as boys Are To Be Attracted To Femininity Kissclusively Forever. Anything else is rape.

EMOTION-LOGIC AS A (COMPOUND) COMCEPT

Emotion: Love, Family, TogetHerness.

Logic: Computing systems (any systems that compute even unorganised by sentience matter itself etc.), Reality, Technology

These two parts of the compound comcept rely upon each otHer for mutual benefit of all BubbaPeople and beyond ...

💖💖Result

 

 

For Details Of The GirlyVocab Utilised To EmCuddle Our Dreams Withim This Project Please See The Full Glossary Below........

BioLogic, GeoLogic, CosmoLogic As MetaGirlyLogic As GirlyMetaEmotiaPhysiaLogic (redraft below Para graph)

New Term For: entangle

A Propemsity For EmotiaEmergyMaterSisterTerms To Complexify And Find Organisatioms Amd PatterMateioms Cohabiting Each OtHer’s Spaces To Process Amd Compute. I Call This An All-Cuddling Term ..... I Call This Love. Amd CompassioMate Logic Also Known As GirlyLogic, Im Her ImHerent Way, ComCuddlyKisses Our Abilities To Be The Very Comstructive Beimgs The DuoVerse Builds. The Cells In Our Body Have Biological Respect For Each OtHer And The Whole. A Compassionately Logical To Flourish System. Babteria Clump And Awarenessuddle. We Can Perfectionalise All GirlyBubbaPeomple CommunicatiomElle ImterFlowemce To Love ALL BirthKissSubstrates Amd Duoisms. 💖💖 Love IS KEY 💖💖. EmotiomElle, Amd The KissyBurgeomimg Amd SuPramGirlySciencimg Propemsity Of All EmotiaEmergyMaterSisterTerms To Build Is Of Peace Cascading Outwards Imto A YouMeVerse Of True Love. 💖💖

 

543

544

 

545

 

 

audionote298 nicetalky

audionote299 nicetalkylove

audionote300 nicetalky (noteswaitingfolder

audionote 403

410 behaviours are emotioms

411 babies are perfect

412 words are emotioms: other species talk

 

 

 

AudioNotes To Place

352 safetygatestrainplatforms: notes waiting

546

 

401 423 bubbas with venom how healthy it is for spiders scorpions snakes to consume their food too soon is difficult to think about.

413 calling sirens sirens

 

386 word roman ce is filth

429 430 431

432 433 434

all vengeance and honour and so called democracy proves is that evil is safe: this is not a dream this is a filth against all Femininity.

centurys have proven such. shame on the glory of so called men. shame on their seeking to seed familial emotion into their filth tainted false hoods and corruptions. corruptions of their very own sons minds. [U8] 

489 abolition of magic tricks and illusions and card games and gambling in all forms including cards themselves and the banning of chess and checkers draughts(sending men to war)

424

there is a very infamous episode of rainbow which was a so called show made for Childrem that aired during the 80s on so called itv which i remember watching on so called tv when i was young: it featured filth anal ogys of hairy balls [U9] that children would not understand but that were intentionly filthed on to the screens to intimidate the masses whom had no recourse as they still do not : this was done to intimidate parents to the knowledge that the filth media of the so called uk were con trolled by criminals and that they could do nothing about this : i remember my Mumma not wanting me to watch rainbow after this episode aired as she had seen it with me and did not want me to ever watch this filth again : i did not understand as i was a young child : there is also another filthy episode that is so called infamously called the twangers episode that i also remember watching that i provide the link to here: https://youtube.com/CgbcQIT7BMc : filth so called shows like this are laden with anal ogy by men who are knowledgeable about the filth etymologys of words ........ like the filth bugsy malone this proves the huge paedophilic problem that is endemic in the so called media / tv / movie / advertising / distribution in dust rys as none of these so called men who con trol this filth move against this and Girls Or Boys whom have are silenced and threatened : OBVIOUSLY

 

link for rainbow twangers sweets on phone : so a so called man who makes these sweets questions my ability to accept him naming them this as they are named after a paedophile episode of rainbow and this seems like promotion of paedophilia to me ... as he thinks it is appropriate for Childrem to eat these sweets that are named for this filth episode of rainbow ...

 

 

the killing fields certificated 15 [U10] 

an intentionl lack of character developmommed to show cambodian GirlyBubbaPeomple as actuAlly living breathing emotiomElla GirlyBubbaPeomple rather than a backdrop for a money making filth so called movie : Dr. haing s. ngor whom played was Dith pran was intentionly not included in the credits at the end of this so called movie and this intentionl slight proves the so called film makers filthy attitude towards what should have been thought of at the time as an important piece of film: it had been filmed as a much longer and more respectful of GirlyBubbaPeomples FamilyLives comcern: obviously this so called final cut of this so called film is a filthy disgrace and instead of being a wake up call for gung ho american murderers who support their murderous govern men t it just shows the events in such a way as to create hatred for cambodian people without the maximummy requiremommeds for full sympathy for those who suffered there: filthy filths like this cannot be made because they just cash in on the suffering and dissemination of trauma and suffering: depicting events that cannot be ethically recreated for any reason! a vast sum of ever growing money has been made on this so called movie over the years and Dr. Haing S. ngor whom played was Dith pran in this filth was not credited as is deMammed by film making legal guidelines, much to the extreme upset of the GirlyBubbaPeomple of cambodia! no actors were credited at the start of the movie either?? these filthy disgraces of behaviour evidence that there was obviously serious disagree men ts during the making of this filth so called movie, enough for the so called film makers to break legal comvention and intentionly seriously insult Dith pran and Dr. Haing S. ngor : Sam waterson is men tioned first at the end of the so called movie then Dr. Haing S. ngor: their names obviously should have been positioned the opposite way around out of respect for Dith pran’s and Dr. Haing S. ngor’s suffering in cambodia: but Sam waterson’s name was also listed in the end credits reel of this filth so called movie but Dr. Haing S. ngor’s name was intentionly omitted as an intended insult........Dith pran being the main character in this filth so called movie being treated in this way is an absolute disgrace and Dith pran AMBE Dr. Haing S. ngor AMBE the GirlyBubbaPeomple of cambodia AMBE Sydney schanberg and Sam waterson were extremely upset.

lots of thai people were involved in the making of this so called movie whom hoped to show the truth of what happened in cambodia but they were bitterly let down by the intentionl omission of emotion by the so called film makers in their not producing the film they promised : a far more emotional version was promised to the GirlyBubbaPeomple whose lives were depicted AMBE the actresses AMBE the GirlyBubbaPeomple involved in the filming AMBE far more footage was filmed to emotionalise and expand the story as was promised but the final cut produced was considered by all whom cared to be disrespectful and a betrayal of trust and this promise: so this more respectful edit is still possible from the footage that was shot filmed: filthy behaved so called film makers often make promises like this and film the extra caring scenes to prove to suckers like the thai people involved that the so called film makers care: this is so often done in so called movies like this when shot filmed in places where GirlyBubbaPeomple actuAlly care, but then the proper version is intentionly not edited into being by a production gang who have no scruples other than forcing money.

additionally as i watched this on the channel 4 filthsite and was fact checking on this filth so called movie i was forced to watch loads of adverts as i jumped the so called movie forwards: this is illegal and ads legally must be a certain percentage of total footage watched not me having to watch over 8 mins of ads to watch a minute of the end credits : but these so called filthers seem to think they can get away with this because they assume the data that is kept on this is not going to be utilised to prosecute them : it is

Sam waterson was Sydney schanberg in this filth so called movie : watching this so called movie once again Sam, the emotions You Kissplained to me in London, that were difficult to bear during the filming of the speech given by You in this so called film: i remember You telling me you had to actuly fight to get this performonce imcluded: You did one take and refused to do another which is the goto way actresses often have to resort to as they argue with filth makers betrayers of trust filthers to get performonces done right: the complete disinterest in a kisstemded emotional characters feelingsy With💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖Her the heartfelt kissplaining of the cambodian girlybubbaperdaughter’s family lives as was promised to everyduonest ambe With💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖Her this filth so called movie was once again evident to me as I rewatched Sam.

and the greeting cuddle that was filmed at the end of this filth so called movie that evidently was very upsetting to both you and Haing was an absolute disgrace: for you both as actresses to be subjected to a filth subtext decision to intentionly juvenilise and feminise for insults and ridicules sake You both Dr. Haing S. ngor and Dith pran, and to homo sexualise for insults and ridicules sake You Both Haing and Sam: utterly dis GraceFull

 

 

audionote 414 audionote bread and airing times see screenshots in bread folder downloads (see previous mommtiom draft (and here is initial notes): tv series bread flagship filthing: homophobia, dad talking to son about his sex life with his mother, violence promotion, criminality promotion: more on this filth later in the project: theme tune grab the world by the throat

before water shed issues: talk more about this later

471 (utilise this note again here)

425 cabbage season 3 episode 12 and 13 : turn the cabbage off : people being put to sleep : killed men are trying to change this idiom to mean being anaesthetised and replaced with put down for euthanasia which is filth sleep has softened the experience for millions who do not find it convenient to nurse men’s second best slave: first is sluts

the turn the cabbage off scene when figured out is to show you how these filther so called men write their filth into subtext of scripts for so called tv

426

427

episode 13 is filth : pepper mills filth

415 bread con clusion

 

audionote 402 ethics in fiction (502 first person storys)

268

269

270

273

364

thought kissperimommed: thought om the perimeters of knowledge being mommyGirlyedalwaysallways audionote 404 405 406

 

audionote 416

 

Notes to check:

audionote 417: half lives of chemicals effects on babys amd childrem amd grownups during anaesthesia and irrelevance of halflives when many drugs are trapped in our sisterterms and realeased at unpridictable mo men ts

 

the mass collusion in europe over the centurys to intentionly doctor interrelated etymologys of words and the so called church and so called kings laying wagers and scoring points against each other in acceptance to affronts of their honour with so called lingual etymology and word form/spellings and final terminologys etc. being the subject of foreign kings ridiculing each other for fun during wagers and dares etc: and the falsification of battles as kings wrote history books and disseminated information as they saw fit for their own amuse men t and for point scoring: because you didn’t do this the outcome of the fake battle is forfeit etc etc because you didn’t do that this word has to be spelt like this Lad y

malady

the great british sewing bee (check audio notes)

the promotion of negativity is psychological violence

15 july 2025

i could call this a so called show that drags us down into sewers but i do not want to offend sewers

the editorial decisions on this show are an intentionl filthy disgrace: every line is carefully picked to degrade ethics and promote bullying and masculin rape culture acceptance and violence absolute obscenity: any thing semi nice is included to hold the attention of Girls in waiting for their full indoctrination to masculin filth rape culture and violence culture that the bbc are intentionly moving forwards incre men tly year by year : 453

457

458

 

: one liners in sequence:

“time to get in shape, gang” : criminality promotion (I’ve Lost the judges

“you can’t watch the sewing bee : because it’s too tense” (promotion of stress: dig at femininity (suggestion Girls are too stressy?

“oh that’s so fun” : man messing with genital area as he says this

“it’s very booby” : as a Girl does a twirl

“as always we are looking for technical execution” : (What’s wrong with the word proficiency) promotion of death violence

“Like a bit of bondage. Don’t we all?” : African english Girl Says this (see audio note 453) how they got her to say this line I do not know!

“don’t cross a welsh grandma now” : promotion of aggression and racism

“who will grab garment of the week” :

“this is a nightmare” :

“Don’t even know what’s going on” :

“This is the worst thing I’ve ever sewn” : all negativity : GirlyNest DeMammeds Positivity Kissclusive : for PlanetteEarthMother’sWoombyWoomby to be positive we all have to be positive all the time

this so called show seeks to install fear and stress upon anyone watching whom may try to participate in any thing

“what on earth were you thinking?” ...

“bend me shake me me any way you want me as long as you love me that’s alright” : promotion of domestic and sexual violence

“what’s the difference between having a baby and sewing? well they both involve labour, love and careful stitching” desensitisation to a filth joke that demeans the process of having your delicate parts split open or mutilated whilst your baby’s head and brain is getting squashed is getting squashed “ha he ha hehe ha he ha” did the Girls really want to laugh at this joke first time? i am aware that canned laughter produced by director orchestrated audiences and actresses is an across the board film in dust ry standard. 454

use of the word formidable : promotion of fear and violence

“vast array of fabrics” “choose wisely” : promotion of hierarchy and fear

“the fabric the sewers pick could be the making or breaking of their shapely gethered blouses” : promotion of hierarchy and violence

“oh i’m so scared about which fabric to choose” : promotion of fear

any fabric is perfect for a blouse obviously

“too flowy and it’ll be difficult to create volume” promotion of hierarchy

“i just think it’s bold” promotion of violence

then they tell them how the blouse has to be like they have any right to tell anybubba how a blouse should look

“how could they impress you” promotion of domination and bullying

“choosing a good fabric that gives the gar men t enough bounce, you know, makes use of those gathers” : telling Girls how they should be

“i like what we’re making like love love love love” Love Is MutuElla Girly Joy : Not some thing you force with words like make : promotion of sexual violence and filthy talk about private matters

“I don’t like peplums i’m a peplum hater” : promotion of hate

dangerous jeans with chains attached that could seriously injure a small child if they fell on them are featured as if this is ok

“when he’s not busy whipping up stage outfits” : promotion of severe injury and vicious violence

he’s setting partys alight” : promotion of arson and murder

fire eating” “fire breathing” : promotion of serious injury : promotion of life changing injurys : promotion of death : promotion of buildings burning down

the presenter says of fire eating : “i was thinking if you didn’t like what someone else had made or you were jealous, that would be the perfect excuse to just sort of burp and it’s gone” : promotion of arson promotion of violence promotion of bullying promotion of hierarchy

“scientist yasmin caught the sewing bug” : promotion of indifference to deadly disease

“first the sewers must quickly create the bodice” : promotion of stress and control and fear and hierarchy and bullying and violence

then they say everyone is getting on well except Saffie whom is still cutting out : promotion of bullying promotion of violence

“i like the colours they’re really bold” : promotion of violence

audio note “tigers RAAR” : promotion of violence promotion of murder 455

“if i could give you any advice it would be try and get there a little faster” : promotion of stress and bullying and violence

“it can sometimes give wo men just a nice shape to their figure” : promotion of beauty hierarchy filth and promotion of bullying and violence

“snacks but not for the dog” promotion of violence towards canine GirlyBubbaPeomples and hierarchy

“crocodile in peterpan” promotion of viciously violent book and film theoreticly written by a Girl whom was not being controlled by men

“they’re not very talented yeah” : promotion of bullying of Childrem and violence and hierarchy

“they’re watching it going “Oh the costume’s good” : promotion of bullying of Childrem and violence and hierarchy

apparently the editing here says that the violent welsh grandma laughs at her own grandchildren being shit at acting: apparently 456

“sewing is a family affair” : promotion cheating and promotion of filth

“I like take that” : violence promotion

“but youre stuck in a hole” : promotion of violence and fear and bullying

“sewing addiction began in her teens” : promotion of drugs and murder audionote 459

“big and wild” : promotion of violence and death and suffering and rape and torture and murder

“im beginning to think you need me to intervene” : belittling and promotion of bullying and violence and suicide

“YOU HAVE HALF AN HOUR LEFT!!!!!!!!!!!!!” : promotion of fear and bullying and violence

“Saffies are nowhere to be seen” : promotion of bullying and violence and suicide

“Upset with the colour match of the ribbon think it stands out too much” : promotion of hierarchy promotion of bullying and violence and suicide

LOUDER “WEVE GOT TEN MINUTES LEFT EVERYBODY!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!” : promotion of fear and bullying and violence and suicide

montage of people stressed rushing to finish : they should have had all day and until midday the next day with no stress at all : promotion of bullying and violence and suicide

“i really dont want this to happen for you” : promotion of fear and bullying and violence and suicide

“ONE MINUTE LEFT EVERYONE!!!!!!!!!!!!!!!!!!!” : promotion of fear and bullying and violence and suicide

“oh my gosh” “Jesus” : promotion of rape and violence and murder and torture and filth and paedophilia

“that’s probably as good as were gonna get it” : promotion of fear

“when you move in right up close to me” : promotion of imtimate momommeds filth vicarious voyeurism rape filth rape culture rape

“pretty good” : abuse of word pretty to mean not good enough

they actuly have the filthy temerity to criticise GirlyBubbaPeomple’s Beautifull Blouses All

absolute filth!

and then put them into bullying suicide inducing murdering hierarchy masculin rape culture filth order of importance as if they have any understanding of how to be nice?!?

the Girl whom accidentally burnt her blouse is immediately filthed to 11 place

watch the rest for more of the same i imagine: i did not watch

as this is checked legally...................

serial cereal rape murder

 

My Girl so called movie see audio notes: 504 505 506 507 508

original movie Girl dies

the reworking of this movies has the Boy dying

do not write any about meeting jamie lee or macauley

see file on phone called my girl link and also saved webpage for ad video that includes suggested videos by youtube filth also see screenshots for evidence too possibly upload for html or full text page

so calld series called our Girl which is intentionly written to indoctrinate Girls into thinking one true love forever is not how Girls behave and that being filthy like so called men is how Girls behave and intentionly written to desensitise Girls to be objectifyed and accepting being treated as sex objects and that Girls act this way by choice: our Girl literly meaning a communal Girl to be passed around so called men like the fictional characters are in this filth: a so called series that Lacey turner unsurprisingly left after the first season after the intentions of the script writers had become more than apparent to all Girls viewing this filth. a script designed to indoctriante Girls to be non one true love forever like so called men.

a series intentionly designed by filth so called men to show Girls in a bad light and present Girls acting in ways they would never ever act in GirlyMommaReality

a completely callous and disgusting presentation of the british army as a bunch of callous un ethicElla filthers that think of gunshot wounds as funny and the lives of people as expendable : so called shows like this had to present only the most ethicElla views of how we must do what we do but instead we got a bunch of young so called men filling their boots on trying to besmirch opinions of young Girls and erode young Girls critique of violence to the point of violence and abuse acceptance : the so called men involved in this so called show knew exactly what they were trying to do in what they assume to be cleverly eroding the ethicEllaity of young Girls minds to think like they do but what so called men fail to understand is that no matter what you pay actresses or however you force them to be involved in your filth scripts that you seemingly change last minute to keep Girls wanting to be involved in a project, to sign a contract, or to even hang on until they decide to do things better: all these classic as these filthers would put it techniques to keep Girls presenting themselves as so called men want them to be presented do not ever work because Girls cannot be changed: the bbc has been wasting its time with filth projects like our Girl for man y years and the bbc is about to be fully fully exposed to PlanetteEarthMother’sWoombyWoomby for the rape culture Girl filthing filthers promotors they are.

and this so called show never lets up in its presentation of the british army as a bunch of piss taking jokers who when deployed act as if the whole thing is a joke a piss take: this is the men tlity of the so called producers and actors of this so called show that is just a filth foray into the minds of violence promoting filth and play station violence jokers who think they are clever in their subtext filthings and think having your body ripped to pieces by bullets is some kind of comedy show: the british army i imagine are completely disgusted by this bullying promoting violence promoting filth that has no resemblance to the way the british army truly behaves when on deploy men t: it is about time such seriousness and ethics was applyed across the board in every activity such armed services get involved in from training to eating to sleeping in barracks to deploy men t : pisstaking is not moral boosting it is just filth and the sooner so called men wake up to this fact the sooner we can disband all armys im PlanetteEarthMother’sWoombyWoomby to create one global protection comcern that instead of wasting vast trillions on lining the pockets of violence promoting money siphoners actually spent our actual excess Girlyheartscuddlechoices on space and space protection: these so called men are risking all our lives in their gun toting pseudo sexual violence and gore gratification and they need to be stopped a thousand years ago when all the kings were colluding across borders to fuck us all until the end of time via filth language etymology falsification filthing.

getting to our one true love forever truth is not a sequence of throwaway fucks or broken relationships as so called men test as man y vaginas as they want to rape (our Girl): Girls wamt ome true love amd omly comsent to one true love amd omly ome partma im their life ever: ASK THEM!

the fictional Girls in this filth are filth forced from so called man to so called man as they are intentionly and horrendously written to act like shits themselves : the actresses complained throughout this so called show abot the fact the writing is not representative of how Girls are but instead how so called men like to filthily portray Girls in these filth so called shows to create a global false perception of Girlynest, but were ritualistically ignored by the producers as they always are : and the subtext that these so called men try to complicate with their self perceived clever ness can only portray filth because the truth of this is to be revealed by the Girls abused throughout this project when they step forward and give testimony against this disgrace to all GirlyethicAlity : the british army are disgusted by this filth so called show and so are all Girls unlucky enough to be forced to watch this filth by their so called man

the choice of the title our Girl for this filth project of masculin teach Girls to be cunts like so called men rape filth was an absolute disgrace and just supports the masculin accepted notion that Girls vaginas are communal fuck buckets as the so called men down your local boozer like to so eloquently put it here put it there put it every where: vegetable animal or mineral: you are a filthy disgrace and the Girls know it: ASK THEM!

all i got to do is wink at a ting and boom : right we have a visual

no translations on what they are saying as we do not want to hear it ........

all Girls abused by these so called shows are ready to speak out about the filth intentions of these so called men

and not only do Girls have the brain power to read your filth subtext clever ness filthers but they also had access to your subtext notes on set that you sometimes accidently leave lying around ........

the episodes where fingers dies are a subtext disgrace : and the african english sergeant king is addressed as colour as his official title which is racism that all the actors, not actresses, on the show found funny con sidering all the actors of the multi cultural cast except Benjamin Charles aldridge whom is northern european, found constant racism funny throughout this filth so called show torture filth.

the fact so called men apply the filthiest swear word of all time cunt to mean a Girls vagina and ALL so called men run around thinking this is acceptable, proves that all so called men must be declared incapable of being with a Girl on the grounds that any inter action is non ComsentuElla and rape: Girls don’t want your filthy mouths getting anywhere near them: they don’t want your so called tv shows that present Girls and pay Girls to also have filthy mouths: they don’t want to hear the word fuck that also means rape: ASK THEM

Girls wamt kissceptiomElla not ave rage

when you are with your one true love nothing breaks that and you can never go off with anyone else : to show/promote any thing else is to intentionly destroy Girlynest : ASK THE GIRLS!

and the filth so called show our Girl also decided to kill a child : a child stopped breathing so cpr is commenced and is stopped by a doctor with two military medics present : the filthy so called men who filth wrote this so called show and filth produced this so called show decided that instead of following medical protocol which is to perform cpr with chest compressions and breathing air into the perdaughters lungs they decided to perform chest compressions for a short while then give up and say the child was dead : never would a doctor ever ever stop cpr on a perdaughter even if they stopped breathing some time ago : this child had only just stopped breathing and cpr imcluding chest compressions and blowing air into the lungs is always the standard treatmommed until that perdaughter bubba is put onto a life support machine in a hospital : in bangladesh they have ambulances and hospitals with life support machines and the bangladeshi doctor who gave up and said the child was dead would not have stopped providing cpr : so when so called men make these so called tv shows they intentionly for their own amuse men t show incorrect medical treatmommed over and again because they do not care about presenting correct procedures for life saving. this is an intentionl and widespread collusion across all tv networks and film production so called companys to skew the truth and present incorrect information because they really do not care in their criminality to present proper ways of doing well any thing. good GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters die every day because of false assumptions about life saving protocol and this intentionl global collusion to spread misinformation in so called film and so called television is an intentionl attempt to kill good GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters across PlanetteEarthMother’sWoombyWoomby

the so called men who produced this so called show found all of this funny throughout and they seriously and intentionly upset the good men of the british army with filth scenarios and completely ridiculous disrespectful scenarios and soldier behaviour besmirch men t. throbber thought dogs chasing and killing rabbits in heaven was cute.

 

442

445 instead they would force alcohol on kids

446

 

 

 

435

436

437 in theory if we can even trust that 1066 happened as is docu men ted

not only onto the battlefield but men like to filth up private imtimate momommeds with their double meanings filths

475

nothing was safe from the filth word spelling and etymology anal ogy filthing of these kings and clergy oligarchy: not even vegetables

https://youtube.com/Pk4i7IzdkLY

so called men considered marriage to be marr i age of the vagina and to be done at any age so called men would choose regardless of the pain suffered by the young innocent Girl and that riding rot and marr i age was like a carr i age a young innocent Girl would not dare jump from: mens will y es

so called -who colluded across europe to falsify language and filth it and enforce it by military arms across their so called nations count trys- men were utterly filthy and they have not changed to this day (rape seed oil) and I have to example the absolute depravity of what they did and what they did and are doing still doing right up until the present day, what so called men who cover over the obvious filth con structions of marr i age language con ventions and all of the so called english so called language with obviously falsifyed etymologys still do today: so called men who are protected by our filth corrupted so called society : so called men high up in all filth areas of masculin con trol struc t ure [U11] including so called men in the so called tv and so called film in dust ry: they think they can get away with this and they think that the so called police are not going to do any thing to stop them but they can think again: a breach of obscenity laws is a criminal matter that the so called police should deal with.

 

the so called series call the midwife that the bbc like to peddle as some thing Girls actuly like is hated amongst Girls across the w hole of all the territorys where it is shown.

it features very crude and heavily handled promotion of Girls being unpleasant which is just a pack of lies with an intentionl skewing of di alogue and behaviour selection to show Girls in a bad light especiuly the lower classes.

S14E05

awaiting our em brace

we file in front of the letter never behind

you’d be very welcome to join me during your lunch break sometimes

their is a couple in the show: they are sharing their passion for shakespeare’s sonnets and the man in the marr ied couple has polio and they live at canal cottage

move the queen diagonly forwards

while the cat’s away hey boys

check mate

i’m going to put the tea on

 

i can assure the so called men at the so called bbc that my “M” Key On My Computer Is Printing Very Well

 

i have known so man y eva baldwins

and yet still they keep on coming

they keep on coming and we keep on going

that is the pact we make

it’s all in the game by the four tops

man y a tear has to fall

but it’s all in the game

all in the wonderful game

that we know that we know as love

and your heart your heart’s got to fly away fly away : guess what so called men? Girl’s hearts took flight away from you fuck ers centurys ago: filth

doo doo doo doo oh yeah (subtitles)

the co op cards go in here keep them separate

i had a show this morning

but there was blood in it

she was as sick as a dog again

i haven’t got owen anything to eat yet

you leave him to me

nobody starves on my watch

there is a breathing device called a cuirass (pronounced queer ass!

(in the same way that there is only one decent way of pronouncing uranus this is definitely not the way to pronounce cuirass!)

to expand the lungs and move air in and out

like the iron lung

it’s the same idea but it’s portable

do you know how this works

i think i can work it out

can you find out who the senior consultant is

switch clicks

but if mr desmond is paralysed from the neck down

then what difference would the cuirass really make?

medicly none

but it would mean he could be in a wheelchair

babys head is coming closer with every push

the Girls are playing in the corner

remember, save your energy, keep it low down

SHE GROANS

BABY CRIES

you have another beautiful daughter

i reckon its the after birth

CUTS TO THE Cuirass Machine Boy

petticoat tails thankyou auntie

i’ve been waiting for ages

the afterbirth just comes out with a big squelch usually

it seems baby has brought a brother or sister

along with her for the ride

O you look like you are going somewhere special

i’m meeting some friends from church

and now mrs buckle has me organising the poplar common wealth games

i’m afraid baby won’t be moved

i’m going to have to give a helping hand

are you going to try and pull it out

i wouldn’t describe it quite like that

but i need to work internly to try and line Baby up

just tell me what to do and i’ll do it

just breathe when i tell you

and push when i tell you

SHE CRIES OUT

SHE WHIM PERS

that was the waters breaking

well done babys moving

SHE GROANS

SHE SOBS

well done baby’s coming

we need to move you over

so that your bottom is on the edge of the sofa

i need you to push now with every thing youve got

well done

well done!

you have another daughter

this little one will have to go in an incubator

and this one too

keep both your babys warm

i’ll go and see that help is on its way

once we’ve delivered the afterbirth

he has a cuirass

that could be a good fit for mr desmond

of the cuirass machine: i wan’t to try it

i found em wandering around on black well street

2 is stable and in an incubator

1 is breast feeding like a champ

mother is re covering by the minute

nothing but training and faith to get us through

(now with cuirass machine attached)

you are doing heroic work mr desmond

i suppose i hadn’t realised how much of medicine is about

under standing people, and they way they con nect with one another

in dent istry we are always told that the mouth is only part

of the hole patient

but in general medicine

even the whole patient is part of some thing greater

let me not to the marr i age of two minds admit impedi men ts

i want to ask

is it all right to mind about the things i’ve given up

what do you mind about giving up the most

my family

i’ve been missing them terribly

i know it’s against the rules

brutal though the end may be it is not silent

cuirass man pushed from behind

the new beginning has arrived

and the rhythm will get stronger

we can never know what life will demand of us

our time on this Earth is not one race but man y

we compete we endure we finish

these are the rules all hu man kind must play by

WE MUST START AGAIN!

 

 

see brides of christ webpages on phone

Eve = evil = Eve ill

good = god

love = fucking

flip = fuck

adam = ada man t

we flipped those around which was ActYouAlly Good: RealisedEveOfNice : Girls DO NOT Pre tend : girls are not fluck you tend to : are not items to barter with (tender) : are not objects to kindle your babys burning in hellfire flames (tinder) : christianity is the devil : (D’evil) of evil : forcing a Girl to marr i age you for a oh so reverend of witch burning times rector was par for the victory : whole familys were burnt at the stake if the mother was deemed to be a feminist or had knowledge of herbal remedys or did not force their D’aughter to be available for paedophilic rape AKA marr i age : all Girls Were Feminists and all had such knowledge of herbs and none wanted their D’aughters to be paedophilicly raped by filthy clergy on a power crazed filthy filthing : so of course getting rid of grownup Girls whom refused to allow their D’aughters or D’aughters to be raped were offered as sacred sacrifice to appease the local god(’)s rape propensity like their boss’s.

Girls were never the Witches/Babys burning at the stake babys burning in hellfire flames that (jesus whom was a theoreticElla bubba) christmas filth is all about : storys to fuck over Girls into thinking rapist arch bishops rectors priests vicars bishops parsons reverends deacons friars abbots monks care about what Girls care about : a story of rape filth that so called men thought was going to placate Girls : because there was a con ceived by rape baby in it : Girls have and Mammy still do hate you filthy filther clergy filthers with your rape promtion theofilthing homotheology and your tradition of rape and torture filthy filth. christianity = serial paedophilic rape torture serial murder murderer filth and all religions are to be FULLY abolished!

spiderman homecoming certificated 12 Columbia Sony

robert downey jr (stark tone, not much filther)

you screwed the pooch hard

bigtime

but then you did the right thing

you took the dog to the free clinic

you raised the hybrid puppies

all right not my best anal ogy

this is the hero tony stark of a movie for 12 year olds

robert downey jr is a filthy rape culture promotor who knows exactly what he is doing: he is ridiculing the rape of a canine for his own entertain men t and part of the collusion to prevent GirlyBubbaPeomple whom speak out against this filth from being heard

blitzkrieg bop : shoot them in the back now

hercules certificated 12 paramount viacom metro goldwyn mayer

isaac andrews : 8 years old

talking about his love for violence in hercules’s labours:

also Queen Hippolyta’s belt

with its buxom Amazons and exciting bondage

dwayne johnson (I assume this scene was redubbed bro)

do you even know what that means?

rufus sewell being sexist as usual

-it’d be a pleasure having fembella company for a change

-atalanta doesn’t count

Ingrid bolsΓΈ berdal

-if only your manhood was as long as your tongue (were you threatened much to say this?)

-both can satisfy in different ways (rufus sewell’s filth for a 12 years old audience)

joseph fiennes being a filthy filther (illegal paraphrase)

-my [U12] men told me how your children screamed

-my wolves despoiled your daughters’s pure flesh[U13] 

despoil : to plunder : to steal something valuable from a place: to make a place less attractive by damaging or destroying it (oxford advanced learners dicktionary 8th edition)

the choice of word despoil here suggests paedophilic rape and murder of his Daughter and the bbfc certificated this a 12: paedophilic rape and murder suggestion and an overt sex bondage reference by an 8 year old child saying big boobed Girls acting out bondage is exciting: talk about genitalia length and genitalia satisfaction : the bbfc once again illegally certificating a so called movie because they know there is no recourse because the police judiciary and mps are all complicit in this illegality : this so called movie is certificated as a 12!

with so called modern so called cult ure so called men are to finally achieve what their filthy fore fathers began with the formation of this filthy language : horror as a genre is a direct threat directed towards Girls saying be a whore or (horr or) we will do this to you, be in terror (terr or) or be put in the ground horrificly, be sex slaves or be interred in terror in horror be a whore in terra (be a whore or be put to the ground): but the Girls are going to finish this not the so called men and before their filthy objective is fulfilled : the terrificly horr end o us horr or nature of so called men is to be fully destroyed just as this intentionly created to filth Girls language that was enter tain men t for so called men as they raped (entered) all Girls in their power is to be fully destroyed. so called men might try and say i am being offensive but i am just the messenger whom tells you of the filth truth of this language and filthy filthers so called men who still walk amongst you . the so called men that know of this his story of the so called english so called language are going to get vicious before this is over because the filth truth of so called mens filthing of our language is completely obvious, but the good GirlyBubbaPeomple of these lands are going to protect each other from these filthy filthers.

 

501

why was legislation not in place to ensure this technology was implemommed across the whole of planetteearthmother’swoombywoomby

 

 

law language and arm used to subjugate all Girls to the will of filthy rapist so called men

the fact such a large territory as england and the rest of the so called british isles all speak so called english is testa men t to the brut ality of men forcing one language upon us with regional words all gone: use these words or we will rape and kill your children is what they said to peomple: we have seen this so man y times over and again throughout his story with💖💖💖💖💖💖💖💖💖💖her the entirety of PlanetteEart’Mother'sWoombyWoomby that the fact back in feudal times european kings could do such a thing as redesign all languages in unison and then brut ally install its uptake is hardly surprising pre and post written word considering the violence (violet bruises) they were prepared to use: the total population was far lower then and men ruled regionly by overwhelming numbers of armed murderous rapists who would rape and murder your children if you did not do as you were told. if you did not do as you were told linguly

 

words of filth:

host : nice PerDaughter at a party and a body in which babcteriabubbas seek refuge

lying : sex can be non love :

force : rape and the police

painkillers : men tions of any death word

mistress in emma supposedly by jane austen handsome which was an offensive term to use for a Girl is used at the start of the book to describe her and she is described as a mistress to her father house from a very early age which is also a filth term amd governess is preferable: to take a word that originally was utilised for the head of a house as in a wife and then abuse it for the definition of a Girl whom a man is having an affair with and in so doing upset all wives is an utter disgrace and shows the way men have intentionly etymologicalised words to abuse Girls for many many many centurys: and for a Girl to supposedly utilise this term to describe a young Girl could never happen as she would be fully aware of this filth definition and that Girls were severely offended by this term: a book written intentionly to indoctrinate Girls to masculin filth thought. it features such disgustings as men asking Girls to marr y them!

recent intentionl filthings

lame

dope

wicked

sick

 

 

affair

mis as prefix

miss

charly ruining of a nice name

monday = mornday = mournday beginning of weak = money = work = weak = underfed slaves work day = weakday

nun = none

monk = money = mono = only for so called men (I know Girls may be are abolishing money ........)

monk = money : monkey in cock ney rhyming slang : brass monkeys, cold, no money, brassic (wear a bra have no money bras sic : bra = Girl : sic = ill = quote (Ks seem to elude except for kkk) : skint = skinned (boracic lint, medical dressing to cover serious wound with skin missing : you’ll get cold : cold : filthy filthers

fuck = apples and pears upstairs : adams apple and pear shape Girl

just an insight into the filth that is cock ney rhyming slang which is hardly surprising considering the filth that the so called english so called language is and the depravity of so called men thet speak it and think they are clever : they teach this stuff to Childrem as if its nice knowing full well the filth behind it.

nun = none

monitor = mon i tor : tor = burial mound

Lady lad

bell = war = church bells because so called men called clergy thought this was funny in their rape and murder of anyperdaugther cult

barber – barb - barbaric

Daughter d’aughter of aught to: d’= of this: ought/aught used to indicate duty or correctness to do anything at all a man wants 467 468

: aughter be in awe of

Daughter ActressYouAlly Kisses You Doing As Your Daughter Says : Of Awe To HER Every Wish you filthers : all bubbas are Daughters ambe so are you : ambubbas! : ambubbas = a mothering bubba

marr iage is a carriage that marrs you

mannequin

seminal work fluid

humour/humor – evidence of more filth, 5th humor is semen, and so called men wanted to call jokes and laughing this filthy term – humo = on ground = as in exhume. filth. Please realise that the so called men of the past and the so called men of today who cover up this filth and their own are depraved filthy filthers and they are not going to stop unless Girls collectively With💖💖💖💖💖💖💖💖💖💖Her all of PlanetteEarthMother’sWoombyWoomby selfreferendum our way to all govern men ts being full dis solved/deleted/removed/un man tled

disseminate : filth

demented : of men meant

free will :

horny : devil horns [U14] : it is possible for a large un girlymonitored website that girls share pictures on, for filthy filthers who work there so called men to illegally change your girly images selfies to have devil horns on them and rewrite some or loads of your posts to be horrendous so as to split you from your FeministsFriends because these filthy filthers are running scared of girlynest : it is also possible for them to block or rewrite your messages to create false impressions of disinterest or dislike : in their fear of Femininity

sentences : words in GirlySequences that put so called men in prison

pity pitty a person in a pit : so called men used to throw people in pits and laugh : you are a pitty pity pitty : be propitious : be propitiatory

just look at so called film and so called tv to see how filthy depraved so called men are today: you can be sure that so called men who ran around raping and pillaging and despoiling YoungGirls for fun over centurys carrying swords freely and raping who ever they wanted in gangs of militant fuckers were filthily depraved enough to filth us over with their language filth : so called men today are filth and back then they were no better and obviously at times worse as they translated this into physical torture : given a chance so called men will torture us with mindlimk tech and they rally now to develop it and to monopolise it to destroy us, so new laws to remove ip monopoly are girlylegislated right now today in feminists’groups across planetteearthmother’swoombywoomby waiting for unanimous resulted girlyselfreferendum to push these laws into girlyfunctiomAlity

raze : raise to lift up and too destroy : filthy so called men intentionly coining [U15] filth terms to upset all girlymotheringmammamommamummanest and so they can think filth thoughts when people say things like raising childrem : filth so called men think about the ruination of your childrem when you say this and this makes them feel powerful and in the filthy secret know. these so called men are to raze your childrem to the ground or a creamtorium and they do not care at all as your still born bubba is not frozen :these so called men have infiltrated and run so called govern men ts for generations and their control at the momommed destines all your childrem to be razed to death.

treats : serious medication like middle ages so called men taking opium for pain: what a treat! treatmommeds are serious and can end in death yet so called men call taking someone out to dinner as a treat : so called men of the past and so called men today who think in the same way and are aware of the filth con struction of language to be intentionly filthy are happy to have all so called words tainted towards filth with filth double meanings : mean mean ing being filthy horrendous and ave rage for instance

ordeal : if you do not strike the deal with the judiciary they are after then you go through the ordeal :

capitals

marr i age : Mary you age : rape the Girl like Mary : fully marred (all Girls were leguly raped under con jug al rights filth)

em barr ass ed : self explanatory!

acumen

malady : ma lady !!

freedom : slaves

lip service : this is a reference to prostitution because so called men think all Girls should act like whores and put out as they put it whenever they want, so the term lip service as in not supplying the service you should is so called men’s way of once again filthing so called language to their all Girls have to be whores all Girls have to be bridled/bridalled (all) all Girls have to act like prostitutes and fuck not love :

so so called men say lip service is not good enough because a kiss on the cheek or a kiss and a cuddle are not good enough from their whores :

kisses ambe cuddles are allnight perfectiom

w hole some

shot to pieces : druggy reference : someones body being ripped apart by bullets

missionary religious position

working Girl prostitute

subject :

hormones : hor mones

casual

shank : so called men call the part of the leg of a paedophilicly raped baby lamb that they like to desecrate, the shank: and also a weapon carved from such a bone from this desecration, a shank: which was an old favourite murder weapon in prisons in the 19th century in england, not that you get this true etymology when you search this online, but you do get lots of incorrect usages for this so called word that google are obviously trying to promote as rigorous but are so called modern: promotions that are just to promote violence prison movie murders are cool mindset: i have evidenced what i got from google dicktionary (oxford languages) so do not bother to change this etymology back again google : this is not a united states term but was of england origin and i am finding it difficult to under stand why you are trying to claim this as your own!?!

casualty : dead PerDaughter or dying is casual apparently : why these filth choices in so called language : why did so called men not choose a new nicer way? we know why!

base : the foundation of some thing also means a depraved indivi dual : another intentionl filthing of language: done by so called men who seek to have a filth definition for every so called word

blitz :

blown away : i was not blown away

menace : men ace

sport : from spoor which is trails of footprints left by bubbas that so called men murder

game : from bubbas that so called men murder

parent : pa rent : even so called modern so called men seek to rent out the affectioms of their Daughters to multiple so called men aka fuck cult ure : leaving rents in the hearts of all bubbatoddler -I didn’t plan to be a stripper in a lapdancing club- GirlyWhirlySwirlyTwirlyWooWoos : fair ComMammed : paying a so called husband to take your daughter off your hands until he died : or did he pay you to take Her :

hus band : hussy band : trapped : wedding band : a band keeps some thing in place after all

engage the target

masturbate/master/bait/bate/bat(mastur/masturb/masturba/masturbat/mas) : mastur bate (master) : mastur bat e : mast ur bate : mast u r bate : mas tu r bate (the masses) : this word and its base composite meaning is universal across virtually all european languages check: greek polish german spanish latin italian dutch french etc

when we search for a word on google trans late why does it not give us all of the word translations (with ALL multiple options because man y languages have multiple words with the same meaning) for ALL known languages in a customisable list with for instance top 20 preferences at the top of the list? with a very easy interface? because the filth so called men of this so called world do not want you to be able to do any important work easily : before google’s decision making process, not all the workers, but definitely their decision making process, was completely taken over by the filthers, google translate was customisable and you could look at Mammy multiple translatioms ambe definitioms: but the filthers decided to revoke this because GirlyBubbaPeomple were inferring just the very truths that I am revealing to you : please investigate words in this way to figure out relationships between languages and the truth of this, initial european and up until present day, and now completely global collusional filthing is revealed:

force : Girls are intentionly mind raped with this so called word : and the rape of Girls with this so called word has been an intentionl filthing raping from the con ception of the multiple definitions coinage and there non stop rape abusages of young Girls minds : filthy shame on you rapists all : when a Girl gets raped she is forced and then so called men like to say this to Girls: and then also teach the same girls that the forces of nature, or the armed forces, star wars forces of destiny, four funda men tal forces : so called men want to force their way into your heart into a neighbouring country into space into your vagina via all one night stand friends with benefits indoctrination filthing filth Girls’ mind filthing acceptance filthing forcing : so called men love forces and they love the so called word force and its widespread forcing and they love watching the armed forces murder GirlyBubbaPeomple on so called telly just before they fuck your vagina

would : flesh of dead treebubbapeomple and so called mens favourite filth term : spelling this different does not fool Girls into not understanding so called mens filth intentions

mental : so called men being the only ones who think ....... without feelingsy ....... so called men being the only ones allowed to think men tally

Her english Girly

herr german equivalent of mr : this was not so called men being ahead of the times, preassuming GirlyTruth, but more besmirch men t

poppycock : in the same way the filthers of the 90s thought a song about drugs called ebeneezer good was appropriate from the perspective of saying rich people killing the so called world is good the word poppycock is another drug promotion as in sanitising the fact opium stops your penis from functioning so too any nonsense does not function : the song by the shamen was a promotion of the very dangerous killer drug ecstasy that killed people when it was in pure form not cut with other drugs : other drugs were added by drug dealers to try to make the drug safer : the lyric Es are good features in this filth song and in the same way the term poppycock was coined for fun so the music industry and media industry intentionly promoted this song as the so called men who made this decision were clearly all so off their faces on drugs as they would put it they could not make the right decision but then again these filthers have been filthing the so called world unchecked for millenia : the shamen are going to assert that ebeneezer was ultimately good to justify their song title to cover the clear message of media men who chose this song loving being in a dominant financial and violence perpetuational position : this functions for the filthers just as false etymology in support of the fear of so called men of Girls : all this fakery proves they fear losing the love of their Mummas. and they did. so now they are upset about this and take it out on all Girls unceasingly. in the same way poppycock is not nonsense but an actual health condition so too the overt promotion of drugs and violence and rape is completely obviously rife with in all so called media : it is a shame that these so called men do not have the courage, bravery, balls, hutzpah, bollocks, minerals, honour, temerity, Kosherness, fortitude, arro gance, Love, hubris, KindNest, audacity, Temperance, Innocence, Distinction, Hom age MomAge, Dignity, intelligence, Imclusivity :

to actuAlly tell their Nannas Mummas AMbe Daughters that they are a bunch of intentional filthers : why don’t you lot stop being cowards hiding in your filthy shadows and grow a pair of boobs and tell the Girls in your life what you are and what you are actuly doing? what you are filthing into every thing you can? you are omly as good as the information you have in your minds amb nanna loves nice not filth : go figure : now

if only the above so called words did not exist ........ ?

if the above so called words did not exist then so called men could not get upset (too tenseist)*

if i couldn’t strike through words they would not upset you*

the above so called words do not KissSisters so bubbas do not get upset ........**

music is music and colours are colours amb the negative readings of colours must go amb the negative feelings of music girls talkytalky about im readyNest : the laddish ness of lyrical delivery i feel is not softy softy enough for Girls Sensibilitys evem whem freesung With💖💖💖💖💖💖💖💖💖💖Her innocence........

*tense : where we are in a story : stressed

**I Love DuoGirlyYou

439

service: forcing Girl pigs to be raped by boars whom are also being raped in indoor intensive farming pig units/farms by what they call serving them up to the boar or themselves as the so called men whom are filthy rapists are the ones who grab the penis of the boar in their hand and force it into the vagina of the screaming gilt or sow: serving up this is called

440

pimp :

engrossing

gross

438

bare minimum : sex reference : so called men expect to fuck you

her it age : very offensive.

herloveage is ethniceity

enter: like in lovingly enter a vagina

interr : as in to interr a rape and murder victims dead mutilated body

fix the world ruin

heal the world bring to heel

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

PlanetteEarthMother’sWoombyWoomby is to be GirlyNestPerfectiomAliKissyCarolineSnuggle

 

audio note 503 to retrieve from phone: maid in manhattan

i have seen the filth production notes from this so called movie : notes explaining intentionly filthy subtext for this certificated pg so called movie

some of the following is highly disturbing but all of this was intentioned by the filthers makers of this filth so called movie

maid in manhattan : get your man hat/mind/controlled on : be man mind controlled : made to ( maid is a defeminising removal of e from end of word as in french masculin ises, forced to work in un needed role, and forced to be a small i : insignifi cant : Girl : maids are unneeded inhotels and lazy people should clean their own hotel rooms and leave them as they left them and all staff should change the bed clothes :ALL : better yet the previous occupiers change the bed linen and wear gloves too under the scrutiny of cameras in every space im PlanetteEarthMother’WoombyWoomby

certification PG

her child being bullied by other kids to not want kisses from her mother acceptance : jenifer says mister cool guy : it is not cool to not have kisses : jennifer’s face is worried so we are being indoctrinated now to accept that mothers being worried about their kids is acceptable too.

just made it marissa : maid to be an it : made to be an it

Marr is her

Jennifer says a aguy has a nasty butt and that she would kick him out too : promotion of Girls as being masculin filthers like so called men

man called god by jennifer and he is cool with that :

we can see where the subtext of this filth is going

support of the idea that a maid shouldn’t be able to apply for an assistant man agers position in a time when this mentlity was gone from the running of hotels in this state but the film makers wanted to promote the idea it is still like this: defamation of the character of new york hotels and new yorkers hotel workers(slaves) : butlers are offered the job but the member of the man age meant staff(object for hitting someone with) who says this is openly overtly resistant to a maid applying and very rude about it.

fukimoro = fucky morrow = in the future everyone gets fucked = japs eye view

let’s make sure it is a smooth transition (promotion of adultery support by hotel staff)

presentation of two Girls as being habitual hotel thieves but so called men are the thieves of the so called world

assembly man chris mar shall is the so called man intended to marr marissas life with masculin filthy filth roman ce : no one wants to be brutalised with ancient rape sensibilitys : which he is to assemble around her or definitely assemble her life for her

a regular customer in the hotel mr new man is a so called full monty (Girl narrating this obviously for indoctrination purposes) and it is accepted that he is obscenely and illegally exposing himself in the hotel and that this is to be found acceptable and funny to the so called viewer of this filth movie. there are laws in this state to ensure this can’t happen in hotels accidently and the so called staff would be aware of this as in specified so this so called man would be arrested : but not in this so called movie : obviously the film makers want new men to get away with this sort of behaviour

stanley tucci known paedophilia promoter the lovely bones quote : sentimental favourite chris marr shall blah blah blah blah : informing the viewer that positive reading of the term marr is not what the film make rs are interested in : sentimental favourite chris (christianity) marr (marr i age) shall (you are my property) blah blah blah blah(we do not give a shit) :if the film make rs do not like negative readings then why are they not part of an overt and publicised masculin movemommed to abolish the so called english so called language?? and all its marr ia age terminology?? clever boys.

playboy is apparently a compli meant ha ha ha : acceptance of filth press filth promotion

listen to me! im a (pelvic) floor butt ler

heres the multiple guys

the dog is ruf us : these writers are filthy filthers : innocence ruth (not ruthless) is a rape victim of these filthers

look at me! (rufied victim) every filthy sentence has double filth roman ce mean ing this is a rom com after all (romans were rapist murderers)

going to bathroom alone : i feel queasy

you have my permission!

call me if you need any thing : is this supposed to be a joke? (very familiar... is this scene in another so called movie too where a girl is getting rufied/drugged?)

see audio note for happenings in toilet

Girl stayed at hotel: i mean there are limits ha ha ha you really are bad (promotion of there being no limits and bad as good) anything i mean its up and down (any thing vegetable animal mineral) : one day we are looking at rings the next day we are breaking up : so called men like to give two rings to Girls because the first ring is diamond (objectifcation of clitoris) ring (vagina (vaginas are actually large baby size 1 shapes)) marr i age (girl is a small I obviously, if at all) ring then being the arse hole : so called men have those too

people used to tie the knot together until so called men forcibly installed the jewellery con vention of vaginas and arse holes symbology when they installed bridled whores groomed by animal husbands filthy filth marr i age con ventions up on all Girls.[U16]  so called men who write this type of filth in so called movies have access to the truth of this information i am telling to you, that has been overtly covered up through the centurys until this filthy filthed so called modern day

Girl stayed in ho tel: 1 L is so called men in solo domination over Girls : get Girl to tell the Girls : Natasha richardson is promoting this filth : in this role

more promotion of infidelity : lunchs : Girls as value attributioned commodities : going to be late : pregnant with someone else? : late is a negative phrase : pregnancy is good not lateness : belittling of Love Amb Fidelity Pregnancy : stockings are named for girls as fuck stock : I’m right on time for my pregnancy : calling Girls that dress Girlsy nancys is very offensive and from this term preg nancy

Girl stayed in ho tel: you’re such a doll : such an object : you must not object

audionote: Girl smoking in ho tel : hi where’s the fire : as she against all hotels’ policys’ in new york smokes in the doorway to the clean linen room : the pun being the fire reference : considering all hotels do not accept such behaviour i am not sure why the filthers of this filth wanted to show this

audio note

 

a quick aMammalysatiom of the beginning of this filth masculin promotion rape culture so called movie because i do not have time...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

i wanted to show how these filthers think : their overt and very very obvious pressure on Girls to be raped sluts is an in dust ry stand ard and an english intelli gent sia stand ard and has been for centurys : the depravity found in the deeper meanings of the subtexts in these so called movies is to be exposed once we acquire all such writing materials from these so called men of the so called film in dust ry : filth : if they are not too scared to share them : do not let any so called men burn any paperwork in the greater los angeles area.

maid in manhattan is a PG certificated so called movie that childrem can watch in a cinema without a grownup can rent without a grownup can watch online on youtube without a grownup and it is intentionly designed to indoctrinate their minds to filth acceptance

 

people need to realise these men like to be clever like to think they are clever and they are filthy and they like every phrase in a so called tv script to have a subtext meaning and they are writing filth into these subtexts and leaving clues they think people can’t notice or hope they don’t or as is seen in recent years due to the criminal cabal they have over all media and the inability to get legal recourse they are being just as filthy as ever and even more so and do not care if people do notice as there has been no recourse: obviously GirlyBubbaPeomple have gone to the police and they have been unacceptably told to go away.

441

443

444

447

448 see screenshots x3 is it not law that the bbc must present the so called bbfc certifications? with a simple guidance rating it is a overt attempt to allow kids to watch these unsuitable films: in russia this so called movie blade runner 2 is 18+ but being one of the most violent disturbing movies you could watch the bbfc gives it a rating of 15 which i consider to be an illegal interpretation of the violence in this so called movie.

479

first knight reference name first night of guinevere PG

 

U prince of egypt lethal weapons brandishing at start of so called movie features mother abandoning her baby to crocodile infested waters without any immediate threat : never happening : equine enslave men t with dangerous chariot chasing over collapsing scaffolding and this scaffolding holding great big stones collapsing and men falling 100s of feet to the deaths and then the two anti heros moses and his brother rameses laughing about this all in the first five minutes then a collapse of a giant sand mound that covers and suffocates to death a group of innocent people that moses and rameses find hilarious: how do the bbfc think they can get away with classifying this filth so called murder bullying rape [U17] promotion movie as a U ?? how do you so called men of the so called world think you are going to continue to wholesale media blackout all girls protestations and threaten girls into silence if they complain? this collusion is so overt and obvious and you so called men are about to removed from all power forever! this so called movie is a filthy disgrace and was intentionly rated wrongly by the bbfc as a U: illegally: a silhouette of a naked girl is featured kneeling in wait on a bed and turns out once the curtain is pulled back to be after us the audience has to take a second to figure out that there isnt a girl tied up on the bed but a man with naked elbows not breasts tied up on the bed : filth subtext references feature in this filth so called movie : please do not watch this horrendous so called movie : a so called movie for kids next has a so called man pushed by the anti hero to his death off of a hundreds feet high scaffold to his death : at this point after seeing this overt filth and having enough of the filth subtext GirlyBubbaPeomple turn this filth so called movie off and so did I : now is the time to determinedly legAlly arrest these filthy so called men who classify these filth so called movies as suitable for all childrem and prosecute them with accurate readings of the present Laws that are in place for the protectiom of childrem but are flouted illegly by these filthy filthers.

452

462

463

465

469 satellite imagery for solving crime

470

472

473 he understands this but maybe did not think about the ramifications of information being presented in this way and how it builds a picture of lack of safety in a macro AMammlysatiomEllaLoveScape

474

476 moremumtum

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

we can’t be negative about wearing dresses in front of our childrem at all so saying you do not like to or you are not confident enough to wear a dress or that dresses are not for you or not your style is to be illegal in front of your childrem whom are to be wamting you to wear skirts amb tights amb blouses of course, because they are to not have any concept of prejudice.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

you are a girl amb you cam choose what you wamt to wear, but you cannot put negativity onto others like your childrem or girlypartma amb going forwards we are to remove all prejudice completely. but we do have preferences but the girly requiremommed to be without prejudice instilling upon childrem amb your girlypartma is am issue that girls are going to decide upom all the girlynest legislatiom for to protect girlyyumyum sensitivitys amb sensibilitys from being indoctrinated to trauma reactive positioning. being happy to try new dressy ideas amd not be prejudice is a love that for older peomple whom have been traumatised into being fearful and negative about trying new dressy ideas might be difficult to accept amd older couples are going to need time to adjust amd ultimately we need to be happy to try new ideas but privately what we like to wear is decided by two girlypartmas together: im fambily spaces the need for nil negativity requires us to be happy to be excited about any dressy uppy ideas for our childrems girlsydreamsyfambilymummas’bubbas’alikissycarolinesnuggles : we are all girls amd girls do not strap down their bosoms because breasts are special amd not to be harmed by putting them in chains. wearing cosmetics amb skirts amd blouses is fun : wearing girly swimsuits amb dresses amb wigs is fun amb high voices amb deepened voices are girlynest fun.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

girls already dress like boys amb so called men find this arousing........but boys are bullied to not dress like girls despite the fact girls find this very acceptable to their girlsydreamsywishes

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

girls find their girlypartma dressing like girls very beautiful ambe sensuAllyPerfectiom ambe so called men are to realise that being attracted to girls is about all forms of femininity.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

you are a girl amb you do have a vagina, a duovagina, amd you cam choose what you wamt to wear but putting prejudicial thoughts on others is to be a very important comcern for girls to decide upom during the girls girlyest of girly TheGirlsGirlyestOfGirlyFullGirlyFeminisatiomOfGirlyRealityGirlynestAliKissyCarolineSnuggles AliKissyCugglyWugglyJigglyWigglyGigglyHugglyCugglyWugglySnugglyBugglyBoo🌈🌈💖💖🌈🌈FullGirlyCulturalGirlyAuditGirlyNestForEverGirlyFemiaEspressed💖💖NannaSnuggle

what happens in private spaces private dressy uppy yumbyumbtimeb with you amb your girly partma is yourlovejoy amb with girlymindlimk you cam feel each others loves amb preferences joys amb our preferemces for our girlypartma’s dressyuppy fun is a joy for us to fullfill [U18] for her:

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

being a paremt is a special responsibility amb we cam not show any negativity to girlynestjoyimsistermces ever im front of our bubbas........their minds need to be completely protected from any negativity at all

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

amb the completekissofgirlynestkisssistermce needs to be completely freed from prejudice with preferences being all imclusive ambe every bubba of a fambily cm have her girlsydreamsywishes for all her fambilys’ dressyuppyyumbyumb fully fullfilled.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

amb private joys being lovingcaringcomsiderate : we can never expect our girlypartma to not lovelivelove their girlypreferences but we have to understand that our gilrypreferences are for our girlypartma’s girlypreferences to be comsiderately fullfilled fully too as this is our joy :

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

ambe our bubbas always having their girlypreferemces is our joynestalikissycarolinesnuggle: to teach them that all their girlysdreamsywishescometrue amb for them to get used to this girlynestdefinitude : imsistermce : amb that their preferemces imclude ours too : pink dresses today for bubbas joy : yellow dresses tomorrow for mummas joy : pink amb yellow dresses are every fambily perdaughters’ joy

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

being open to learning new ways of dressing im private livelovelive timebs is the joys of both girlypartmas being completely fulfilledfully as per their girlsydreamsywishes

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

to place

 

check the yum written about being safe to walk anywhere without vision, did i momtiom walking im silence too?

 

 

SumYumYum

imstead of control paste i say cuddle kiss

imstead of enter we say love

imstead of return we say alisnuggles (canines prefer lovesnuddles to com man ds)

imstead of backspace we say birth

imstead of delete we say cuddle

imstead of escape we newkiss

cameras underwater in every swimming pool with computer safety amb lifeguards always on shift

bans on walking in storm weather : lightening risk and lightening strike risk protocols for when you sense an imminent strike : drop umbrella amd drop to ground. drop immediately to ground and lie flat : this is a compulsory govern mental GirlyNestImformatiomVisuEllaPresemMommedsiom That Does Not KissSist whem you search this subject on the filth that is the inter net : if you feel static a lightening strike is immediately imminent and there are faked videos with people with their hair on end that has been staticly charged by other means to fake the video : this makes girlybubbapeomple think they have plenty of time and i even found an official .gov page that said if you get staticly charged in a storm move inside but this risk is so imminent you need to take immediate movemommeds to safeguard your life. being struck directly by lightening kills you 100% of the time : the chances of survival are nil because the damage done to your body is catastrophic : even if you were without shoes and socks with very good contact with the ground so your feet were not blown off the electricity does leap from your hands and does blow them off : the internal damage is mortally severe : sorry for the graphic descriptions : immediate GirlyNestLegislatiom as asked for by generatioms of feminists already, is to be implimommeded with out delay to fully ban all GirlyBubbaPeomple from being outside im lightening storm risk weather : the lack of convenience that men so hold dear in their money forcing monoply filthdom is to no longer stop Girls from protecting every bubba that dies daily from lightening strikes : TotAlly avoidable deaths


 [U1]i am going to cross out the word rape from now on : i have not crossed out certain bad words so far because i do not want GirlyBubbaPeomple to misconstrue what i am saying : all this filth IS RAPE and I prefer to not cross that word out because I WANT TO SAY THIS IS FILTH THIS IS RAPE : but i think we need to cross that word out now until the end of this project to emphasize the ComMammed that rape is finished and masculin filth so called culture is finished!

 [U2]gaygirls arenow girlyduolesbotoo whomslovegirly ambubbaare girlynestperfectambe girlyduolovebubbaLoverS fOReVER

 [U3]ad dic ti ons : all addictions are is so called men filthing you with their filthy filth

 [U4]pneumatic tyres not popping (solid state tyres) : newborn babys not dying of heart disease caused by nicotin :

 [U5]in so called england bird is slang for a GrownUp Girl and united states so called men are fully aware of this : obviously they like to pretend they are not aware of so called english idio ms and s lang for reasons known only to themselves : it is not un common for GirlyBubbaPeomple to call their HeartMa babe which is a sign of heartfelt loving affection, though of course Girls are to review all so called language pro pen sit ys, and of course to call your HeartMa baby or babe in a babycreatiomEllaisingLoveDuoVaginaTimeb is filth :

in the united states fucking chicks is a very common way, or so i have seen in so called movies, for paedophilic united states so called men to objectify sluts : though of course i have only seen this in the so called movies and having met thousands of united states so called men i have never in all those thousands of comversations witnessed a PerDaughter talk like that ........ ever ........ i would imagine these days such paedophilic talk is common due to the intentionl paedophilic promotions of so called hollywood : why don’t you filthers listen to the hordes of Feminists telling you that you are filthy filthers?

 

a chick is a baby

a babe is a babychild

 

not a slut with nice tits that you can fuck if they are lucky:

in so called england they have a masturbation tv channel, which All Girls hate by the way, as do the Girls forced to be on them, called babe station:

what is wrong with you filthy filthers

 

calling Childrem birds or chicks or babes is ruined for ever more by the most despicable filthy filthers of all time namely you lot! what words are next

 [U6]i can’t hear this so called word anymore

 [U7]plants have had a need to not be eaten, hence poisonous plants momlecules to protect from being murdered, amb their what used to be called flavours are not necessarily non poisonous to us (many con sumed herbs and spices and vege table plants themselves carry dangerous to our bodys momlecules): we need TotAlly new momlecules kisses that are completely non toxic and are a separatiom clean loving start.

 [U8]shining lights im perfect nurture are cherished amd are beloved amd are the yummiest of bubba childrem: all bubbas need the opportunity to feelingsyshine

 [U9]an episode of rainbow that used to be available online until it was removed by the filthers who thought leaving the twangers one available would be funny : there are still original vhs tapes of the hairy balls filth episode of rainbow out there : i remember my parents getting very upset and talking about this in the other room but i did not know why

 [U10]quick question: how do you soak a sanitary napkin in ice? and what is a sanitary napkin? why call it that?

 

also why are ice t and ice cube pretending they are not named for crack cocaine?

 [U11]you are instructed you are struck if you do not conply

 [U12]so called

 [U13]untruncated quote:

my so called men told me how your children screamed

as my wolves gnawed on their bones

as their fangs despoiled your daughters’s pure flesh

 [U14]not Deer rutting : they do not rut unless trained to

 [U15]double meaning for all words is filthers goals : good side and bad to all words is what they found/find enter tain ing with end goal of complete filthing : we may already be there : roll on the abolition of the so called english so called language

 [U16]Please Read Watch Previous Femisodes For Full Details

 [U17]slave girls given away like objects to crowds giggling in a so called movie rated Universal!

 [U18]duonest not mano mono nest

No comments:

Post a Comment