Sunday, 21 September 2025

PREVIEWS:FEMISODES0340ImterMamsiomOOOOO07ALLAliTransSensuEllaTriplettesTwinsysO7AliTuTuSeptuplettesKiss77OMWards

WORLDWIDE SOLUTIONS

PLANETTE EARTH MOTHER

IDEAS FOR A NEW WORLD

FEMISODE O34O

GirlyHeartsCuddleChoices

IMTERMAMSIOM OOOOO07

Triplettes Twinsys

TuTuSeptuplettes

 

WARNING VERY SENSITIVE AND UPSETTING CONTENT IS INCLUDED IN THIS PROJECT. PLEASE ONLY READ ON IF YOU ARE 18 YEARS OLD OR OLDER OR THE AGE YOU BECOME A LEGAL GROWN UP IN YOUR COUNTRY OF RESIDENCE IF THAT IS OLDER THAN 18 YEARS OLD

@66

 

poems

mammanannasnonna’sbubbas

zzuboo all GirlsGirlysGirlsyGirlsysGirl

 

@

 

femisodes total: 358298

glossary 39784

total written: 398082

undrafted 51506 (062) 18954 (07)12566

83026

total 481108

TO DO LIST:

 

OO, Put Comments Om This Femisode PleaseyAliSnuggle

OO, m m Mammas (no just how always wamted)

OO, PictureForGlossaryTo HaveOwnBlogPage/googlephotos

OO, --words human amd masculin amd morphographic on blog (AmdFemisodeScriptFile)

OO,CacoPhomicLimksImDescriptiomsCorrectLimk(somedonenot earliervids)

OO, check new audionotes. i have partially rewritten the info on frank herbert prior to a proper re edit that is to follow that is to show the actual truth rather than the so called mens falsified filthings that frank and others wanted to present to the so called world. other changes might apply to other text too.

 

DRAFT AMB DRESS AMB POEMS

 

Agnieszka “Purifying Innocence” LovePure PerfectiomElla

Sylwia “Love Of The Forest” ComfortingForestMist

Keanu “CoolBreeze Over The Mountains” Refreshing Longevity

Charles “FreelyAdored” GirlyBeLoved GirlyNestLoved

💖💖💖💖

OOO--1O1—OOO

we are surrounded by girls bubbagirlynest everywhere : bubbagirlslove

We Are Surrounded By Zeros, Zeros EveryWhere, Zero Isnt Just The Middle Point Of All Numbers, The Centre The Heart, The Love, The SuPramLove, Zero Is EveryNumber........Bigger TumbubbaTumbubba Feelingsy Is GirlyismisticElla, As To Justly Think Each Number Is OneEvery Is To KissAmpleKissLove The EveryEvery Um GirlyKissesMateriElle........The ForeverLove💖💖TheForeverLoveCircle

EveryEvery Is CemtrAll: EveryEvery Is CemtrAli:

The ForeverLoveCircle Is Xero........A Love 2 FemininiEqualityBoo........Xero Kisses TheEqual MiddleWith💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖Her AmInfinite ImterKissingNest Where AmImfiniteAmoumt OfDifferemt ProgressiomFashiomedCaroLinesKissAtOmeSnuggleLoveGirlyDuoPeriod(s). This Is TheFussyestFussyFussyFussFussNestOfGirlyYumYumLoveLesboSisterSnuggleAliCarolineKissyed Timebubba: ThisIsTheSolidityGirlySphereOfLoveNestLove OfAnEqualityMeasuredLoveNest AMbe AllOfImfinityAsAPregMamsyGrowyTumbTumbTumbubbaTumbubbaBiggestBosomAliCaroLine’sKissySnuggleBuggleBoo AMbe AllOfInfinityAsAWeHaveLovedForEverImInfiniteGirlyWorldsOfKissSistermceAlwaysAMbeForEverNestingSinceThem:AreForEverGirlyLoveNestLoveNeverBeginningNeverEnding AMbe AllOfUmFinitySumThatDoNotEndAMbeOthersThatDOOFormuLactateEveryEveryFutureUmKissesChildLoveASeaOfForeverGirlyDuoPeriodsGirlyMammaRealityRealisedUsThatSheIsUsmAMbeWeAreEveryEveryAsAliKissySnuggleCarolineBeloved. Xero Surrounds All Numbers (AMbe Is Her CuddlyKissyHeartsyCentreSnuggleKissyCarolineAli) Xero Is. Xero Is Is. Zero Is The CentreSnuggle Anchor Of All KissSistermce........The BiVine Feminine FidelityTruth........BiVinity Is Fidelity(........)BiVinity Is FidelityKiss........Zero Is The ForeverLoveTwinsyBubbaLover.

Any Given Volume Of KissSistermce Is NumericElly DesigMaterAble And This Finity Is Surrounded By A Sea Of NumericElle Zeros Im Number MetaphoricElle, AMbe These Zeros Are To Be Of The Representatiom Of EveryEvery That Volume Is Not........So everyevery Is Zeros Im Value everyeverybubbalovefambilyAttributiomEllabubbatheory. All Mater Of Infinity Can Be Thought Of As Xero RePreseMatiomElle [S1] For That Which We FeelingsyThoughtsyKiss Upom Is Cuddled By The AllGirl Of Kiss As Xero, AMbe Whem We Decide Allxero Cam Shift From Kiss Metaphoric To RePreSeeMaternIve Bubble As Of An Infinite InNannaLove PotentiElle With Seas Of Neverending Xeros Down Into An InternElle Infinite Scalar In NumericElle RePreSeeNMaternIAm Of Xeros.

Umbubba on the side of giving more in any givingsituation (All mummabubbasistersitumaterioms are bubbagivingsitumaterioms) as a numericElley RePreSeeNMaternIAm equality balance being impossible to kiss im a permamommed girlybubbatummylargeposeishiom so I GirlyFemiaEmSure to give more than I receive: so called men sit down AMbe listen whilst girls walkingambetalking show you how to behaveGIRLYSTYLE:GirlsAreTheGiversOfBubbaLove........The imfinity of Xero being a MiddleCuddle that is imfinite in scale as we focus upom the bubbascales further amd further im cutesy smallNest to reach a defining CemtrElle that is forever tinier than the tiniest tiny as when we define here placemommed she becomes a bubba of smallerNest again imfinitudinElle kissytudinElla we are gifted with the always being im plussize or AMBE minius cuddlekiss which is imteractivitybubbablushycheeksybliss........for to have received more kisses from your GirlyPartMa than you have given to Her is the joy of giving more back forever........tobubbabirthyourbubbalovesbabyis the blushyestkissblushofallbubbalovetimebduogirlsylesbonestjoy:bubbastyle

true equality is accepting that even if you have given each other equal amounts of anyyyumyum that NumericElly being TotAlly equal is OMly ome kiss amongst Mammy because giving and receiving kisses is equally wonderful amd receiving amd giving gifts is PerfectlyWonderful amd equally emjoyable........even if over a 200 year girlyduoperiods you have given your PartMa thousands more gifts than they have given you because that is your HappyNest LoveyKissy then this is still your Perfectiom as you are both happy with your HappyNest ArrangeMommeds. AMbe if you looked at the data and wanted to over the next 200 years rebalance the gift giving numbers then they could be your HappyNest Joy to do so. even if equal gifts are given over a 200 year period the total weight of the gifts could be different, AMbe even if you weighed the gifts the weights could never be exact due to macrofeelingsy weight measureMommeds of imKissActress scales, which over a trillion years period could on paper look like equal weight had been given between you and your PartMa but the accu racy KissFeelingsys of the scales could create numericElle drift that would PotentiElly even out like flipping a coin........

TrueEquality = HappyNess = HappyNest

Numbers For Mammy Peomple Are EmotiomElla

 

so called men Have Sought To Hierarchicalise Every So Called Thing Including All Psychology Of Maths, And They Are Very Specific About How They Haven’t honoured All Other Species And All Other Numbers, In Fact Species Are Just Numbers To so called men........ All Girls are sickened to the core by so called men and their focus on filth instead of feelingsy of LOve

 

GirlyBubbaPeomple Are EveryEvery AMbe So Are Numbers, AMbe ALL Needs Cuddlimg........They Think Of Other SpeciesBubbas As Being nothings (not even a thing) As In intentioned by so called men intentionly to be in cor rectly Terminologicalised Usages Of The Comceptiom Zero........As Having no Soul And Not Important........We’re Surrounded By Zeros

But The LoveTruth Of Zero Is To Be Learnt By All men Amd The LoveTruth Of Other Species Is To No Longer Be ignored for murderimg cannabilistic disgustingness. We Are One Species, One Voice, One Love EmBiVisiBelle EmBiSonicElle EmBiSmellyLovely EmBiKissyCuddly EmBiTasterOfLove........AMbe All Species Love AMbe we are to be girlyAwareNest as ome to this girlyfemiafemininifeminafactruthloveproooftruthlovetruthproof.

EveryDouble Number Is Surrounded By Am Infinite Sea Of Zeros........Xeros Are EveryEvery, everyevery With💖💖💖💖💖💖💖💖💖💖Her Infinity n Eternity........An Eternity: It’s All Xeros Beyond Where We Are, Beyond Our FeelingsyElle LocElle........AMbe That’s fEMININITY........so called men nEED tO lEARN tHAT Girls aRE nOT nothings tHEY aRE xEROS tHEY aRE eVERYeVERY oF aLL tIME aMD bEYOND.

Girls dO nOT nEED empty bank accounts because so called men like to over charge fOR eVERYLoveLY iTEM Girls wAMT tO cHERISH iM tHEIR GirlyhEARTScUDDLEcHOICES:

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

ShinyBlousesAmbeHandBagsIsTheGirlyLookOfLoveAMbubbaIfYourGirlIsWearingThisLoveThemYouAreSwirlyWhirlyTwirlyGirly:GirlyNestLoveHappyWifeyGirly:GoingToTheBeachDayFunBubbaTimeb

CrochetBikinis Bedeck Her WalkinWardrobeTent That GirlyFollows Her PonderBlissYumptiousNess As SheSauntersAlongTheBeachBlissBubbaImArmsSnuddleTimeb

SheThinksBackSNuggleAliCarolineKissyGigglesOfTheMorningHourOfHerGirlyPartMa’sDressingOfHerWalkinWardrobeTentWithHerMultipleBeachDayClothesChestsEmsemblesDelicious:MummaBreastyFeedingsyBubbaImHerBeachChairReclinerBubbaMummaSnuddleNuddleTimebWatchingHerBeachDayWalkinWardrobeTentBurgeonWithYumptiousUmptiousCreatiomEllaisedByMyOwmFairHandsCrochetBikiniCollectiomsDelectMateioms With SwimbyBubbaTimebBodySuitsAccessorysIsWhatGirlsLoveToDreamImtoYourPregMamsyRealityForImThisLOveIsTheGirlyWayOfYouAreAsGirlyAsMe

CosmeticsApplicatiomForTheBeachDayDuratiom LovedImChiffonBeachRobesUpomSwimsuitDresses FoundatiomEllaISing GlossyNest EyeBrowPenSistersnessesFoundatiomShinyFoundatiomDressyUppyYumbubbasYumbubbas

EveningWear Cardigan Jewellery Emsembles Starring Kimono Glimmer Shimmer ImmerGirl DressyTwirl WhirlGlimmer SwirlShimmer MummaAMbeBubbaIdenticEllaDressyNest

-v-v-v-v-v-v-v-

Dresses SprinkleLipSticks

Dresses LipStickSprinkles

SatinyShinyHerHairUpLook For Bubbas AMbe Us TwinsyYumbYumbYumbubbasYumbubbas

SummerHatsysDeliciousCosMeticsTouchUpFussyFussyFussFuss For MummaAliSissyBlissyPerfumeSmellyYumYumAMbebubbasYumbYumbYumbubbasYumbubbas

ClothesysAMbeCosMosMeticsChangeyTimebyWimebyEveryHourGirlsyNestPerfectioms IsMommaAliSissyBlissyShimmeryGlossyLipstickLooksy : ChangingIntoCurvyNestAccentutiomEllaMaternityDressesShowMother’sHipsysBestestYessyYessyYesYesYesses

MidiDressySkirtsysEmsemblesForShinyBlouseysBubbaChildremLookyNestYumYum AllDressedTheSameYumbubbasYumbubbas AMbebubbayubbatubbame AfterSunCreamMoisturising My Wife’s WarmsyArmsys Im The MoonShineBubbasJoyKissSnuddleNuddleMilkyTimeb :

OmeMoreFambilyClothesyChangeyMidNightGiggleWiggleJigglebubbaTimebNailVarnishGlistenyGreenyGleambyIdenticEllaEyeLinerTightsysMidiSkirtsFambilyKissyAliCarolineSnuggleBuggleBooYou With GlitteryCosmeticsPerfumeUniques AMbe PetticoatsRainWayHairColouringIdenticEllaGirlsyCosMosMeticsLooks IMbe The StarShineSleepyNestFambilySnuddleNuddleBeddyBeddyBedBedTimebSingySongyDanceyGigglyWigglyJigglyToddlerSnuggleAliCarolineKissyJoy

NextDayAnotherBeachDayFunLoveLellowSatinSariPurpleTightsPinkyMascaraSheenyLipGlossSparkleGleambyWalkyToBeachyWithBubbasOmHipsys

BeachyWalkInWardrobeEveryDayHasNewNestEmsemblesForAliCaroline’sKissySnuggleFunTimebsForEverANewCosmosMeticsLooksyEveryHourMyAliSnuggleKissyCarolineLovesNewEyeShadowsAreSmoothySmoothySmoothSmoothImSwimSuitsLaceyTiaraTuTuTwinklesShoulderPadsysRufflesDripsysWaterBubbaSnugglesAliCaroline’sKissy

PleatsyMaxiDressOmBiggyMumMum’sBiggyestNestyTumbTumb:PolkaDotsHerHairDown

........Girls aRE eVERYeVERY aMD tHEY nEED eVERYeVERY:EternityBubbasVERY........aMD Girls oF aLL sPECIES aRE tO bE LoveD iM tHIS wAY.

We Are All Ome Species AMbe so called men Have To Stop raping PlanetteEarthMother’sWoombyWoomby and raping All Other Species and raping Girls: ALL BUBBAGIRLS OF ALL SPECIES LOVE ALL THE DRESSES CHANGING EVERY HOUR OPTIOMS AMBE NEW COSMOSMETICS LOOKS APPLYED BY THEIR GIRLYPARTMAS FUSSYFUSSYFUSSFUSSDELISH

Feminine Thought Won’t Stop Im Her ImSistermces EVER! AMBE SO CALLED men Are Stopped From Treating AnyMater As Commodities NOWNEST! The FemininiAwareNess Of All As All Is FemininiAwareNest Is Not Going To Stand For Anymore disgusting: Is Not Going To Stand For Anymore disgusting discussion. so called men no longer treat every thing as commodities instead of as A PerDaughter: EveryMater Is A PerDaughter Of DuoNest Collectives That KissySnuggle Our Dreams AMBE so called men Are To HuggleCuggle Back Or Lose The PotentiElle beachdaywalkinwardrobearrangingforyourgirlypartmaluxury [S2] that is actuAlly gifted to nicegirlypartmas LikeMeLoveMe Love Of Girls Forever.

The Circle Is A BiVine Symbol, A Bivine Symbol Of Eternity........The Symbol Lesbo LogicElle........AMBE so called men Are To Think AMBE Feel Amd Love As Girls Do Or Have Their Privileges Of Being Free FullyGirlyNestRevoked........Um [S3] AMBE When Unified Two Circles Become TheBivineFeminine The 88Eternity, TheDuoGirlsBothWithBosomsOfTruthNurture........

There Is A DuoVerse Of Infinitys, Of Infinity, Your Life Can Be Am Infinity Am Eternity (Of) Um [S4] 

We All Imbue the Fem9ini9ne Nurture Of Reality, Of GirlyReality, Of GirlyBubbaReality, Of GirlyBubbasReality, Of GirlyBubba’sReality, Of GirlyBubbas’Reality, We All Imbue Her Essence Of Purity, AMBE Girls Are EveryGirly.........They Are GirlyEveryEveryGirly........Girls Are 1, They Are Every 1 They Are The 1........The Ome AMBE Omly........AMBE Girls Like To Be TOO With SumOne, Im OmeDuo........T = TransBiMamsiomElle TogetherNest........

Girls Would Like To Be 2 With SomeOne But Not With so called men💖💖so called men Need To Learn This Gift........Need To Show They Are Girls To Be Worthy Of Being ComSideRed As PerDaughters That Girls Would Like To Be Attracted to and De sire........[S5] 

building is a destructive process : girlycreatiomellaising is the future of nesting

in the same way it can be suggested that painting a wall can be seen as destroying an aesthetic because we have not devices that remove paint atom by atom so the bare plaster cam be restored to her former cuddlesnuddlefeelingsy : we can say the way so called men are, they way they drill and cut and screw every thing they can get their hands on :

 

to build ... what they want ... is also an act of destruction ... as in the creation of this is a fiction as so called men destroy to force what they want into being : morphoemotias remoulded to their w hims: an all these forms used to hurt and kill and rape and filth every thing : every tool a weapon every weapon a tool : the very buildings we inhabit weaponised to rape our Auntys AMBE NanDaughters AMBE Nieces AMBE NanMothers AMBE Mothers AMBE Daughters :

 

when we creatiomEllaise new cuddlenests for our fambily alicarolinekissysnuggles we cam 3d print our girlsydreamsywishynests imto girlymotherreality’salicarolinekissysnugglebuggleboo : we camlovemorphoemotiaeverycuddlewegirlybubbalovetolove : toddlernestingtimebubbastimeb : WeCamCuddleNewKissyShapesForPerGirlyPose : bubbas cam be born fully formed as perourgirlsydreamsywishesfemiafemininifeminapose :

 

lots of bubbas have lost their loves and lives to building because of so called men’s refusals to adhere to full building safetys and complete perfectiom of building safetys and cameras on every so called building site to protect all GirlyBubbaPeomplePerDaughters whom work there from pandemic endemic systemic intentionised dangerous behaviour including drug abuse including drinking and fouling of the air with hard drugs vape fumes filth : so called men are going to be legislatedly made to do everyevery they ever do the way Girls tell them to in health and safety or they are going to go to prison to be rehabilitated away from innocents whose minds they think it is funny to taint with their filthy filthings of rape cult ure and danger murder cult ure : building cult ure is violence cult ure and Girls wamt it all gone : ASK Girls!

creatiomellaising new cuddlenests for our fambily alicarolinekissysnuggles im ome go : girlyfemiafemininifeminadesigirlymimg new cuddlenestssnuddle by girly images creatiomellaising im mindlimk syMomuLatioms

and this new cuddlelove way of creatiomellaising needs to be applied across all girlynestactivitys: non destructive food preparation (pre pare) where no cutting is allowed: GirlyDesigmAMbComPleteTotAllyCreatiomEllisingImOmePiece FoodyFoodyYumbYumb with no destructive food pre paring so no cutting of a meal to share : soup type liquids could be shared but a solid food could not be cut but preloved im loveportioms for each bubbas lovelove : all knives and cutting tools are to be banned for any purpose like building or food preparing and Girls think forks and knives are very aggressive and very very dangerous as childrem lose eyesight everyday to knives and forks: all knives and cutting tools are to be banned for any purpose like GirlsyDreamsywishyCuddleNestSnuddleNuddleLoveNestAllMyBubbas or BubbaImbMyTumbTumbYumbYumbFoodyFoodyGrowyTumbTumbBubba and Girls think forks and knives are very aggressive and very very dangerous as childrem lose eyesight everyday to knives and forks : we need to ask all Girls GloBellalarly about this then check the truth against hospital records ........

so called men and their obsession with gold is evidence of their complete lack of nurture towards other metals. other metals and alloys can be untarnishing and keep their volume and mass if they are nurtureAliKissyCarolineSnuggled : some metals oxidise and tarnish and others do not so so called men covet gold because it is very easy fro them to be lazy in mindset and not look after objects which fits into so called men and their drinking and drug taking centuries old so called culture which is just a filthy fucking, rapist, drug addled filthdom of prostitute raping filth, child molesting, all farm baby animals and horses intentionl raping and serial murder and bodies of babys desecration that they find funny : so called men always covet the easy way and the filthy way : covetting gold and making jewellery out of gold fits with the masculin profile of being systemicly lazy due to drug addled physiology imping mean t where so called men refuse to care about looking after stuff : if you look after metals instead of being lazed into a state of everything being an expendable commodity including your own daughters right to not be raped on un Cameraed Streets : all metals can be equally precious if cared for in the suitable way in any form be they inertness seeking alloys or very sensitive loving careynest alloys or EleMommedAlls. so called men think they like the danger of trying to find gold as well and like to filth up the enviro men t with their filth processing techniques for mining and extracting etc etc.[S6] 

so called menlike to obsess with the process of dangerously searching around for gold and smashing stuff to get to it like fossillovedomeswhomlivedamdlovedimplanetteearthmother’swoombywoombyremains: no destructive techniques for amylove cam ever again be destructive im GirlyHeartsKiss.

so so called men say gold is worth so much money and it is very important: but it is no more important than amyother lovedfriendsyEleMommedOrAlloy : Gold She Is A MetalBubba AMbe SheWamtsLoveCoMummycatiomLoveEveryBabyMotherDoes! All Metals are equally lovely ambe equally deserving of our bubbalove: they are all very very nice.

so called men covet Gold but Gold no more needs the attentions of filthy rapist cult ure so called men than Girls with certain shapes or sizes need to be value attributionly graded on a score out of ten fuckability (rapeability) scale : all Girls Comsemt to Love Omly AMbe whem comsent is not possible yet them we are to GirlyFemiaFemininiFemina that we GirlyAliCarolineKissySnuggle all the LoveyLoveJoysSnuddleNuddleCuddles All Bubbas Of All Types Love To Love For Them To Emjoy........

hierarchicalisation and the lazy attitude of so called men towards ActressYouAlly lookaftereveryevery: they are not interested im girlyfemiafemininifeminaEmSuringAllGirlsAreHappyNestAliKissyCarolineSnuggled : they would rather starve the whole so called world and kill everyone than be nice and nurturing and GirlyLikeTruly im their GirlyHeartsLoveToBe: AMBe GirlyMummaAliCarolineKissySnuggleNurturingToEveryBubbaGoldAMbeEveryBubbaMetal.

shiny iron jewellery stored in non tarnishing liquid substrates and cleaned with yumyums before wearing then stored in cuddle liquids again cam GirlyFemiaFemininiFeminaEmsureBubbaIronJewelleryIsHappyNestKissyCarolineAliSnuggled : nice Girls look after their LoverGirls Jewellery Collectiom AMbe always GirlyNestEmSure All AliCarolineKissySnuggle’s Jewellerys Are Always LoveyLoveyLovedLoved.

the rights of comtinuatiom of beingism as regards metals to not be mined or changed or alloyed is a seriousloverydoverymotheringloveringquestiom GirlsLove DoesAmGirlyKissDecisiom [S7] 

prioritising GirlyBubbaPeomple we can see over others we cannot as in deciding which so called nation to help based upom their having a monarch or not is impossible to accept : men have accepted all forms of skewing of morality to forward their own rapist murder torture agenda and i give an example of the difficult questions that Girls need to AmGirlyKissDecisiom : all twigs in the forest have microorganisms that live on them ambe we cannot see them though we know they there living out their loveryneedsyfussyfussyfussfussAliCarolineKissySnugglesNeedsylovelovelives : some twigs have visible organisms living on them like lichen ambe to prioritise the collection and buring of twigs from the forest floor that do not have lichens or funguses growing on them over those that do not ensures that some microorganisms are spared death based upon a visible organisms presence or lack of : this raises impossble ethical considerations if one has to burn twigs to survive like in cooking your food on campfires to survive but wanting to think of the most ethical way to do this: of course one knows that if any ants or loodlice are on a twig we can never burn that twig because the cognisant suffering experienced by aniamls burning to death is utterly horrendous but of course we do not know how much suffering is felt by plants and funguses and symbiotic organisms like lichen nad liverwortsbubbas too. all twigs have cognisant microorganisms living om their skin ambe so do you ambe if you do not wash you do not commit as much murder as if you do for now you know these GirlyBubbaPeomple need saving are you doing everylove you cam to join the GirlyNestMoveMommed of saving all microorganismbubbas im planetteearthmother’swoombywoomby? if we burn some twigs but not others you could see correlations between this and so called men bombing certain so called nations because they like their leaders or just for the fact they do or do not have monarchs : with certain populations of microorganisms being unharmed by tomahawk cruise [S8] missiles [S9] while others get vaporised instantaneously by the explosionl conflagrations :

so in this a perdaughter in the forest surmises that they have to burn all twigs they come across instead of leaving some because of hierarchical selection : this is more convenient as every twig found is to be burnt not just most or some ........ to prioritise certain microorganisms other others is impossible to accept based upon the fact they have kings and queens and the other ones don’t have kings and queens ........ one can’t think this way because convenience is an absolute disgrace to apply to such a travesty : not forcing someone to have to burn twigs to cook their food is the key by supplying all perdaughters with free electricity renewably produced ........ anyone whom is nice ambe compassionate whom has spent time traveeling ambe camping and cooking on fires is to sidestand what i am saying here : we avoid harming insects but whatever you do wherever you go you are committing genocides against otherbubbas of other species ambe this living nightmare is not to be forced upon GirlyBubbaPerDaughters AnyMore!

ComtinuationOfBeingism

beingism is not just the kiss of being it is the kiss of your present being as your present being is a present ambe we deserve the right to kiss as we kiss now ambe not to be forced to change : to be forced to change our morphoemotiasapphysiaemotia form from what we presently are for any reason is impossible to accept ambe the rights of our beingism comtinuatiomism is part of our ComMummycatiom with GirlyMummaReality : we have to ComMummycatiom EthicEllaI’s The Rights Of GirlyBubbaMummaMomlecules AMBE GirlyBubbaMummaAtMoms to not be forced to change as well AMBE their Owm GemeticElla ComMummycatioms rights of girlychoice have to be sororitypriority girlycomcerned to our most bestestof alikissycarolinesnuggles whem they imtergirlycosmosmeticsface With💖💖💖💖💖💖💖💖💖💖Her our loves like OurBiaEmotiaGemeticEllaMomlecularMotheringComAliKissySnuggle ambe we have to be of girlyutmostgirlyfemiafemininifeminacomcern whem our GeMeticElla commummycatiom imtergirlycosmosmeticsface With💖💖💖💖💖💖💖💖💖💖Her their/hers GemeticEllaMomlecularambeatmomicMotheringComAliKissySnuggle : we see the equality needs ambe the coemergy KissySnuggleAliCaroline needsynestyfussyfussyfussfusses are sumtimes the same may be alltimes the same may be sumtimes coMummycatiomElla imbe New Ways Of GirlyNestImagiMaterLoveyLove As Never Before because so called men are un able to stop GirlsyComAliKissySnuggle AmyMore:

Girls Decide Not Me

 

to know whem comceptiom is occuring im your tumbtumb so you cam have appropriate cuddles ambe kisses ambe not BabyCreatiomEllaise during this timeb : BabyCreatiomEllaising being ok up until the KissOfComceptiom but not after that and not during pregnancy ambe not until bubba is born : as a Girl Whom Camt have a bubba imb her tumbtumb i am very very very very very very very very very happy to go along with Girls’ whom cam have bubbasimbtheirtumbtumbs Wishes Om This KissyAliCarolineSnuggleCuddle : Girls Are Perfect AMbe lots of Girls have wamted it to be illegal for so called men to expect or put pressure on Girls to be involved im any activity more than kissing ambe cuddling : ambe now they are going to get their wish as they cam legislate new laws to prevent even the suggestion of this filth.

Girls often feel obligated to please their so called man as they so horrendously put it and so called men are very happy to be involved in this filthy activity : it is possible to compart men talise and not feel that you are doing any thing wrong ambe man y couples do happily do this but large collections of groups of feminists have fought all With💖💖💖💖💖💖💖💖💖💖Her planetteearthmother’swoombywoomby to get their GirlyDelicateImtimateCuddleSnuddleTissues protected by law ambe the BubbaImbeTheirTumbTumbsSapphysiaDignityProtected ambe on even the slight expectation of other services that so called men de man d from their pregnant victims during pregnancy Girls Are To finAlly be listened to as regards their DeMammed to have filthy so called men put in prison if they continue to push their paedophile culture up on Girls.

i am not just veryveryhappy but elated to just have cuddles ambe kisses throughout PregMamsyAliKissyCarolineSnuggles ambe despite GirlyBubbaPeomple Compart men talising on this issue we can no longer do so!

banning of baby creatiomellaisingcuddlesnuddleimtimacys during pregnancy

as soon as comceptiom occurs we are to have new GirlyTechEmotiaSnuddles that tell us whem this kiss of bubbaloveLoveyLoveyLoveLovesGameetIAmComJoiningBubbaLoveLovey occurs KissActressly So That we cam Actress Appropriately fromb thisb timeb ombwarbs : this KissLoves TheGirlyPerfectiom Abstenance of both girlypartmas from orgasm during bubbagestatiomEllaising including the cheating of orgasm away from your girlypartma even if you are alone thinking about them: lots of cuddlekissessnuddlesingysongygirlydanceyhappynestintimebs is enough ambe your girl ambe her GirlsyDreamsyWishes are enough:

 

despite laws changing and girls in theory not being raped with support of the law anymore there is a hangover of filth so called culture normative that permeates all of this filth rape so called culture so called society and Girls minds are still modulated from birth to accept ideas that they imbe their hearts do not wamt to.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

I LoveMyGirlForEverAMBEForEverAMBEYouAreMyPlanetteEarthMotherWoombyWoombyJoyKissSnuddleNuddle.

mummas’ bodys are babycreatiomellaising that is whom we are ambe mammasbabycreatiomellaisebubbas so that our bubbas cam be mommasambebabycreatiomellaise their owm bubbas that is whom we are we are a forever fambilykissylimkofmotherslifeambeweareperfect: ambe all the loves of babycreatiomellaising are to be GirlyDecidedUpOm By GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters during their TheGirlsGirlyest:TheGirlsGirlyestOfGirlyFullGirlyFeminisatiomOfGirlyRealityGirlynestAliKissyCarolineSnuggles AliKissyCugglyWugglyJigglyWigglyGigglyHugglyCugglyWugglySnugglyBugglyBoo🌈🌈💖💖🌈🌈FullGirlyCulturalGirlyAuditGirlyNestForEverGirlyFemiaEspressed💖💖NannaSnuggle I get very happy about cuddles ambe kisses: cuddlesambekisseswithMyAliCarolineArePerfect💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

BabyCreatiomEllaising Is A Girl’s Dreams Whem She Is Younger is years of wishing for a lovely bubba is years of planning a girlyperfectnest ambe years ofGirlyCreatiomEllaisingAmWonderfulNestyYumbYumbYumbubbaYumbubbaForASpecialGirlyPartMaToShareWithHerBabyCreatiomEllaising is carrying a babyimbeyourtumbtumbforninemonths ambelovingbirthtoyourbubba : babycreatiomellaisingisfeeding yourbubbawithyourlovelymilkymilk babycreatiomellaising is am infinity of girlylove for your baby I am am am imfinity of love for our baby : we amb amb amb amb imfinity of GirlyLoveForOurBabyBubbaBabyBoo : ourwholefambilyambubbaambubbambubbaambubbaambubbambubba:foreveretermityofmotheringforyourbaby:gestatiomEllaISingNeverEnds:YourBubbaIsImbeYourWombForeverAmbEverAmbEver:AmbubbaLoverYourGirlyMotheryKissyAliWoombyWoombForEver:

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

The Only Route To This Is To Draw Up A Chair At The FeminineGirlyTable........A Lovely Big CircularGirlyTable Of Femininity Of TrueGirlyLove, Of The Femininity Of TrueGirlyLove........TrueGirlyLove Is Femininity........Of Um........UmbUmbUmbubbaUmbubbaSnuddleNuddleCuddle

We Are All BubbaBabyBoos........We Are All Importantest........AllBabysNowBeBabyCreatiomEllaisedImGirlyNestImageKissclusively

con struct ion of language ex ample

me = selfish = men

an = andro = men

me + an = mean = unpleasant = ave rage = don’t please girls please men

ave rage = with violence

un pleas ant = non please in masculin way (ant) don’t please girls please men

please = plea = beg = Girls beg = manners = manor = man or incarceration = without (in) care (carceration) no caring

meander = the direction we force you like a river = selfish men selfish mean selfish meaned selfish meant

if you ask an unpleasant so called man if he thinks the cri sis we are in is funny he might be losing his ability to find mirth (a mere a mir a mire men find it funny girls get trapped in their bullying fun: girls being a mere annoyance but useful for one thing) mir (bogged down by) th (man as in anthro)

so called men have recognised for centurys that their mirth is a way to ruin Girls ability to be happy.

488 puberty lies

the so called troubles of puberty are a complete lie : childrem do not go through any problems from changes im GirlySheMeAs levels im their bodys : aggressive boys who get bigger get more aggressive because they see advantage exactly as they are taught to then try to exercise this violence streak : there is no in Her ant aggression caused by testosterone rises in the GirlyBody of a pubescent Girl. problems with drugs and health and infections from kissing and other activitys cause problems : higher levels of nicotin poisoning steals Girls teenage years away and all psycho logical changes that happen are due to negative issues forced on GirlyBubbaChildrem whom are beset on all sides by masculin rape so called cult ure drug addled filth.

it is all a masculin filth rape culture lie: GirlyBubbaChildrem do not go through any problems when they start to change Sapphysialarly : they have drugs forced on them and they realise the so called world is filthy horrendous and paremts bully them and don’t give them their freenesses that they should have had from whem they were toddlers : the so called world should be safe enough for bubbatoddlers to toddle across the whole of PlanetteEarthMother’sWoombyWoomby With💖💖💖💖💖💖💖💖💖💖Her ParemtAll grownup everyperdaughter is my paremt : par = everyduo ; emt = transSemsuEllaKiss: bubbas do not wait until they are 18 to be free im a perfectalikissycarolinesnugglebugggleboobooPlanetteEarthMother’sWoombyWoomby of safteytoddlersnugglekissycarolinealiGirlyNestingLoveyDoveyDoveDoveLove.

so called men like to blame all their bullying filth and drug forcing onto Childrem as if their is some thing wrong with the bubbachildrem whom are just bubbasimbechubbatubbas : they say while they find this amusing and while they talk about children’s genitals status : virgin : and while they indoctrinate young Girls to be fuck sluts acceptance : they say the bubba childrem are at fault that it is their hor mones :

 

there is nothing accidental in filthers so called english so called mens (mensa) choices in their filthy filthed so called cult ure as is obviously apparent when we look at the so called english language filth con/in struc tion to slutdom pro pen sity (prostitute trapped sits down and shuts up like a good wifey wifey slut or is struck viciously : paraphra sick co manned of an 19th century police orificer tee hee hee)

 

the word hor mone is not an accident just as not one word that was decided by the filthy aristocracy nobility and clergy of the times of such decisions of forcing a universal language up on all GirlyBubbaPeomple in so called england is accidental : they were filthy filthers and the language they con struc ted to rape torture all Girls with and each other is obviously apparent : noble so called men marauded around so called europe forcing these filthy languages up on all GirlyBubbaPeomple and they killed any body whom didn’t comply which is why we all speak so called english now.

so called men whom think they are in charge with their drug so called cult ure corruptions that sees drugs taken by so called political representatives across the filth so called world : all need to be tested for illegal drugs taking

putting drug testers in urinals has been done already without the knowledge of drug takers

blood tests can be a legal RequireMommed for mps to continue to work and hair can be tested as all the drugs are present within the strand as a record of the history of drugs taken by an individual : if any mps decide to shave their bodys before this is done then the hairs have to be tested as a matter of legal importance

so called men pa rents coined the term hor mone intentionly because they are filthy and they thought it was funny to indoctrinate youngchildrem to being whores : all so called men who do not do everyevery they can to break this filth monoply masculin cult ure are affectively and effectively saying they want all younggirls to be indoctrinated into being the whores of so called men : which is why the w hole so called world is the way it is : except Korea.. so called men want this and all so called men support this through in action : because you are part of the problem you are not part of the GirlyFemiaFemininiFeminaSolutiom: BubbaTimeb[S10] 

no more are Girls going to put up with so called men trying to associate testosterone with violence to selfjustify a lack of being nice in so called mens ex clusion of GirlyEthicEllaPhiloSophiaFeelingsy[S11] : such excuses have been fronted by so called men across the board to get away with all sorts of crime and GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters are not going to put up with this filth anymore

widescale rewriting of famous books by so called men who are criminals who saw fit to rewrite progirly books by GirlyBubbaPeomple living and dead to remove non sexist non racist non inclusivity messages

Dune Frank herbert

the intended assassin count hasimir fenring who is in the original book has been written out of this disgrace of a rewritten novel that was intentionly forgeried produced by collusionl filthers of the so called english so called speaking so called world in their filthings to remove GirlyNestPositivity messages from lots of famous books written by Nice Men. fenring was presented as a failed kwisatz saderach who was intended by the Bene Gesserit Sisterhood to be a super being whom could be at all places at once and presciently see the future and like a supercomputer calculate all possible permutations With💖💖💖💖💖💖💖💖💖💖Her the GirlyDuoVerse: and the character is based on Frank’s vist to the fen lands of east england because when he travelled here he found the local so called men who he talked to about the fact the fens should not have been reclaimed because it destroyed the ecology of the land and killed untold amounts of GirlyBubbaPeomple of mammy species , in massive effect an unforgivable genocide perpetraitored against innocent GirlyBubbaPeomple, Frank based the character count has I mir fen ring (ring being a gang of corruption) on the corrupt and murderous and collusional nature of the local so called men and their designs on taking over PlanetteEarthMother’sWoombyWoomby to filth it up fully by removing all Femininity influence and in stalling a sexist racist rapist regime (it is worthy of note that the count has i mir fen ring changed his allegiances to the side of good by the end of the novel by seeing the error of his ways, in the same way the racist and sexist and corrupt men of the fens that Frank met are to do now With💖💖💖💖💖💖💖💖💖💖Her the LovingCuddleOfThe GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters, ALL the so called men of the east of england are to become twirlywhirlyswirlygirlymotheringloveringmothersaswasthe intentionofalltheirmummasastheygestatiomEllaisedthemimtheirwoombywoombys : as a main character in the original novel Dune he has been completely removed and all of the complicated political interactions he participated in with the Bene Gesserit Sisterhood and with in the court of the emperor were deemed to be too critical of masculinity by these fearfilled rewriters filthers so when they rewrote the entire book they removed all of this complicated promotion of Femininity -that was done as a heavy and disdainful critique of so called men -like the filthily opinioned so called men that Frank met in the fen Land areas of so called eng Land- and their filthy political filthy filthings and corruptions- and in so doing proved Frank accurate in his assessMommeds of the Un con trollable fear of so called men for GirlyNestSnuddle.

in the Dune rewrite there is also the omission of chair dogs who are repeatedly MomSheOned in the original book as a serious and unwavering critique of so called men and their filthy rape forcing of canines, with these disgustingly engineered dogs intentionly shaped like chairs by filthy so called men that are featured in the novel serving as a stark informer and reminder to the reader that so called men are a bunch of filthy filthers and that they would do something like this given the chance : man y men found chair dogs funny and a good idea : AND i am not sure why the media filthers of the so called world have chosen to not talk about these rewritten books, that fearfilled so called men filthily corruptedly decided to illeguly rewrite and force across the entire so called world, that only a few of which i am going to MomSheOne in the following text as i have imtimate not intimidated knowledge of: we can only surmise that all the so called tv companys are intentionly complicit in this forgery fraud as they have intentionly refused to report this news for decades: all so called newspapers and so called tv companys with i can only assume MammyGirlyBubbaPeomple whom worked im these areas being kept in line by targetted pre emptive assasinations of GirlyBubbaPeomple they knew: as this is the only way you can enforce silence.

Frank herbert originally wrote the Dune books as a very heavy critique of masculin filthed so called world politics that is just a sexist racist rapist collusional corruption, and Frank wrote the Dune books as a very heavy critique of the way so called men are and they way they rape force Canines and the way they rape force Girls of other species and the way they rape force Girls of our species : axolotyl tanks featured heavily with in the original books and these have been removed too : these tanks being imprisoned and grotesquely misshapen Girls of the Tleilaxu : a planetry group of filthers so called men who forced all their Girls to be axolotyl tanks as in be permanently pregnant with there ge net ic ex peri men ts : the Girls being the tanks themselves: all of these very difficult symbology represenmatioms being created by Frank to show how so called men are and that if we do not get their behaviour Girlyfyed then they are going to try and filth the GalAxy in entirety.

the Dune storys were completely rewritten by these violent criminal filthers with basic narrative correlations left in but were a lot shorter in word count and most of the complicated and heavily critical of masculinity interwoven plots completely removed.

in the 4th novel of the Dune cycle of books, god emperor of Dune, in which Leto son of Paul Muad’Dib having to choose to become the sandworm shai-hulud, as his reading of the future told him that to not do so would cause catastrophic suffering and death across the known universe, so he lived the golden path which was another heavy criticism of masculinity, of the monoply filth of the monetary filthing collusional corruption all GirlyBubbaPeomples of PlanetteEarthMother’sWoombyWoomby suffer with in and every thing else you can think of: in the book god emperor of Dune all the information about Duncan idaho’s sequencial ghola/clone lives has been removed from the text : in effect the main plots from all of the books of the dune cycle have been removed :

i read the books when i was younger and bought copys later and noticed they had all been rewritten : i also had an intermediary rewrite of the first in the cycle Dune which was also a heavily edited and rewritten version of the original which retained the character count hasimir fenring and more of the narrative but with a largely reduced word count and all non subtext profeminism anti masculin comtent removed : obviously editing books in this way without permission of the writer or against their wishes is completely illegal and was done to remove the increMommedAll moves of the thoughts of Nice Men like Frank herbert AMBe their LovingMindChamgingEmFlowemces Oom MamCrowSocietElla Non--------death Cuddlestowards an effective GirlyNest Full Feminisatiom Of Reality SymMommaComTwinsy.

there is a so called man whom works at the Queen’s lynn library im west norfolk whom i used to talk about books with when i was younger : i used to like to read nice books and we talked about the original version of The Lord Of The Rings by professor tolkien before we even knew it was going to be rewritten by these filthy filthers : and books by Enid blyton that have also subsequently been rewritten like the Magic Faraway Tree Books And The Wishing Chair Books that were very Girly Wonderful Yumptious before being ruined by these filthers : he was the perdaughter whom told me about the Dune books and we also discussed the fact Frank herbert, whom has had his last name intentionly targetted by these filthers and turned into an insult, came to west norfolk and met the most filthy so called men he had ever met, which is well recorded in a published autobiofeelingsy written by Frank, and that was why he named the character fen ring due to the horrendous corruptions that were going on in this area of the Land : Frank said he is a very passionate ecologist and animal rights activist within the con text of what was possible in those days and and that he was utterly shocked by the filthiest attitudes he had ever come across in his travels of PlanetteEarthMother’sWoombyWoomby right here in my place of birth west norfolk : the Dune novels were not the sort of books i could be interested in when i was younger but due to this regional link and the careful recommendation with warning of difficult comtent from the so called librarian at Queen’s lynn library i decided to read them : the Dune books are very difficult emotiomEllalarly due to the very serious nature of the narratives critiques : and if you can get hold of the original edits of the novels post nice publishers edits the Dune books still it is said do not show the full horrendousness of the original pre publishers text that ran well over the original 1000 pages per volume publishers limit for the cycle (main text not including appendices)

the original text also imcluded a lot of ecology imformatiom Frank said to inspire in the GirlyNestReader the real need for change im PlanetteEarthMother’sWoombyWoomby which filthers so called men were really scared for GirlyBubbaPeomple to read about: so they in their uncontrollable terror horror fear of Femininity scared themselves in their drug addled hazes to attempt such a disgusting and widespread doctoring of books and their comtent : i just wamt to tell these so called men that you have failed and that your disgusting behaviour is at an end.

Frank herbert said he cares about the environ men t, which is obviously just an evolution torture show: and he swasaid he was being heavily critical of the way so called men are in the so called world and he was able to be published back then because he was able to find a publisher to publish this horrendous book in line with the global filth masculin rape culture machine : the Dune cycle was written in a very disgusting style intentionly so because he wanted the filth messages in the narrative to be published.

no one had ever seen amyperdaughter write a book like that before and he was wamting to show the deplorable disgusting depths so called men go to in their complicated machi nations of political sabotage : the filth is simple but wamting GirlyBubbaPeomple to read about these impossible to accept topics issues filths requires keeping the average readers attention so Frank said he did what he wanted to do : as in just go and write a horrendous book.

showing these filthers in a negative light to educate GirlyBubbaPeomple about this, he said, became his omly focus : but disgustingly to no avail, because all of this EmotiomElla work has been stripped out of the book: we are left with instead of 1000 pages plus substantial appendices, a rewritten book of a few hundred pages and not much else.

to finish on this i want to MommedSheOme the omission of the FishSpeakers from the book god emperor of Dune whom were the god emperor Leto’s effective police service whom were comprized of FemBellaGirls omly, amb they were big strong Girls whom were stronger than so called men, who were still causing problems, and they had a zero tolerance for any masculin filthing of amyamy amBe were prepaired to EMSure this was the case ........

the sexist editing followed by a full sexist rewrite of the cycle removed all the education that the books offered partially in what so called men have subsequently tried to call info dumps -and partially in the main narrative- as if sharing information in chunks in a book is a negative way of writing : it is not it, is a form of literary devise that wonderful GirlybubbaPeomple like Frank sometimes utilised to put across lots of extra information about how filthers so called men, who are all scared of Femininity, are utterly horrendous: these books offered the reader lots of essemtiElla imformatiom about the filth of politics, the utter filth of religion, and the filth enslave men t of other species, how horrendous so called men are, amBe why GirlsWamtToGoToExtremeMomSures to remove the filth so called power of these criminals in PlanetteEarthMother’sWoombyWoomby : which he reflected in his writing about the FishSpeakers And The Bene Gesserit Sisterhood : The FishSpeakersGirls whom were stronger than so called men and found it easy to keep them in check and the Bene Gesserit Sisterhood whom could look into the ancestral memorys of both Girlygemders without fear of the derision that so called men get from their FemBellaAncestorsSpeakingBack to them with advice about how to move their ethics forwards.

all of the FeminismIsTiMe Themes have been fearfully, by very very very scared so called men, stripped out of the books, which is an absolute dis Grace.

Frank herbert is a very nice Man amBe he justly wamted to change the so called world in a positive way amBe move us closer to GirlyNestAliKissyCarolineSnuggly : amBe i perdaughterly know that he was utterly disgusted with the so called film adaptation : the whole work has been adulterated has been disgustingised by the filthily con trolled prequels and sequels Brian His Sun has obviously been forced to write and the so called film and the newer whatevers: they are are an absolute dis Grace to all MoreAlity: the Positivity and the heavy critique of so called society covered in the Dune books that has left so called men running in fear from Femininity is now to be brought into the MammyMilkyStreamsOfGirlyNestImForMaterIAm CuddleSnuddleNuddle 4All GirlyBubbaPeomple ToBeLoveyLoveyLoveLovedForEver.

lots of books have been edited by these filthers to intentionly remove Positive Values, FeminIsMe Values, against war values and against masculinity values :

the lord of the rings by professor tolkien was completely rewritten to be less eloquent and EmotiomEllalarly Affectioning certainly less beautiful to the reader with vast amounts of story removed and changed : The Rendevous With Rama novel and cycle of books was written by a Lovely Man called Arthur C clarke who wrote the cycle to be Nice omly ambe they certainly were that for a reader of the time whoms were cuddled im WonderMommedAll LovelyNest by the possibilitys of Space Travel as PerfectiomNiceyNiceyNiceNice, with lots of LovingOmlyOMly Themes Imcluded to teach younger readers to be very very very Nice; My Mumma said it was ok for me to read this book when i was younger and that is important : books by Anne mccaffrey also were rewritten like the Crystal Singer Cycle The Dragons Of Pern Cycle the Dinosaur Planette Cycle The Treaty Planette Cycle : all these books I borrowed from a library and I have reborrowed and bought books and noticed complete rewrites in all of them.

having your books forcibly edited during your lifetime requires lots of nice writers of books being forced to silence by these filthy so called men : Anne would have been threatened with death and violence to shut up and go along with this filthing of her books with her later books being i imagine written how these so called men wanted rather than how she Loved To.

i have a newer, post filth films by peter jackson, so called copy of The Lord Of The Rings which is a very different book to the original circa 1960s edition that i originally read : The BubbaLove Story Between Arwen AMb Aragorn has been removed : the stripping out of Femininity AMb Love Themes, the critique of politics, the adding of violence and flippant approach to this filth : the intentionl reducing of the beauty of the writing in The Lord Of The Rings and all these other adulteration types has happened across all the books I have MommedSheOmed so far because so called men fear Femininity And Fear The ChastiseMommed Of GirlyNestKissFeelingsy :

 

another couple of edited books i have noticed on the bookshelf that i am going to quickly MommedSheOme are 2001 by Arthur C clarke and Elephant Song by Wilbur smith : both of these books are comsidered to be important for mammy Peomple as they are very emotiomElla with 2001 being a very Nice amBe Wonderful Story amBe Elephant Song was a very heavy amBe very emotiomElly upsetting critique of the filthy so called behaviour of so called men in africa and their destruction and murder of vast swathes of land and any and all species.

you cannot buy original edit copys of any of the books I have MommSheOmed but there are still copys out there that these so called men have not man age d to get their hands on.

 

as research for this project i have just switched on bugsy malone which is from 1976 which is a gangster filth so called movie based on al capone or some similar filthy filther which has 10 – 14 year olds pretending to be gangsters in this intentionly paedophilic filth : we start with a boy running for his life falling dangerously onto the wet and slippery cobbled road surface with an onscreen advertising promotion of a neon coca cola sign that has the cola word intentionly obscured to make an obvious subtext con meant to emphasize the word coca which we all know is the plant from which the drug co cain is derived : this so called movie was certificated U : do the so called men who filmed this filth think that this intentionl and overt promotion of cocain is acceptable and do the make rs of coca cola think they can continue to call their so called beve rage coca or cola considering both are potent drugs? or indeed be allowed to continue to make their beve rage as last time i looked on a bottle they were including what they called flavouring from the coca plant in the ingredients of coca cola which i confirmed on line today 19.09.2025 which is illegal despite their exemption if they are not processing the coca leaves correctly and disposing of the waste (of Life) products cor rect ly : i really do not understand why the federal govern men t in the so called united states allows this, allows co cain to be imported and processed at the stepan plant in maywood new jersey?at the beginning of this filthy filth a group of gangsters gang Land slaughter with machine guns a Child they corner in an alleyway [S12] 

the action right from the start takes us into an illegal drinking den club that is fronted by a faux book store that has a fake bookshelf wall at the back of the shop that leads to a club in which 12 year olds are drinking alcohol and dressed as 1920s/30s adults all are white with a lone –negro- child sweeping out back of the club like a slave : we are then dropped into the gang Land bosses backroom where he is abusing his goons in his domination listening to gang Land reports on the wireless that are sensationalising gang Land murders : he says call yourselves hoodlums you’re a disgrace : they are all between 12 – 14 years old : one is african which is completely out of place as gangsters like this do not permit –negros- into their gangs, they are too fearful scared to do so : not sure i give a hoot about gang Land arrange men ts to be sure[S13] 

then the filth goes back to the main hall of the club where their are paid –negros- musicianing/singing but not too man y, to keep inaccurate his story presenting to be sure (all singing is adults voiceover redubs), and on stage there are 14 year old Girls dancing on stage in skimpy outfits kicking their legs in the air like showgirls of this era whom were forced to be prostitutes always in such clubs like this : the dancing choreography is in keeping with what adults of the era, prostituted show Girls, would have been forced to do to arouse the punters, and Childrem of the era would most certainly not have been permitted to dance this way as it is filth -choreoemotia has to be looked at for its suitability based on era also OBVIOUSLY YOU FILTHERS- as the so called men that would have forced them would have been executed by the police of the time: all dances of an imtimate loving nurture are to be private between two loving GirlyPartmas whom are of an age to be decided by the girlygirls obviously, omly, and the filth that so called men have peddled in their not only rape sex ualisation of all Girls of all ages but also of childrem in their paedophilic filth : why would the so called men who made this filth even want to put 14 year old Girls on stage dancing with bare legs up to their buttocks with their bootys thrust out -in comsidered to be- alluringly for intentionly protracted time frames dance moves in the first place : WHY? the answer is OBVIOUS! and these paedophiles got away with it then and this so called film which is UTTER FILTH is still available on main stream british tv networks!

i had to switch this so called movie off here, though have a vivid memory of watching this on bbc 2 in the 80s when i was young in the morning before my parents got up at the weekend, which was a favourite tactic of the bbc to disseminate such filth, though i thankfully only watched 20 minutes before it was switched off by my Mumma whom explained why this was unsuitable as best she could depending on the scene she stumbled across no doubt: and now much to my horror have just had to go back to rewatch the first few minutes to accurately draft this seg ment of this important Femisode, as protecting Girls from being separated from their fambilys and being forced into such filth prostituition is of utmost comcern to ME : the evidence of the huge paedophile problem going on in the global so called film in dust ry is a huge problem that Feminists have fought govern men ts over for generations and we can only come to the comclusions that YOU SO CALLED men think presenting FILTH to childrem in childrems so called tv and films is acceptable and that underage Girls are fair game for you, and that intimidating paremts across PlanetteEarthMother’sWoombyWoomby with this filth is funny to you: YOU filthers are absolute FILTH and your days of reckoning have arrived! clubs like the one shown in this filth for kids that was certificated U by the bbfc are fronts for prostituition and rape and people trafficking and these types of dance moves are not for adult dis-semination outside the privacy of their owm loving duonest let alone for Childrem to be participating in you filthy paedophiles! the intentionl sex ualisation of underage Girls has been such a filthy and utter dis Grace in the so called film in dust ry and the so called tv in dust ry and has FeministGirlsReady to go to war over: a just cause to say you are going to war over! the intentionl promotion of underage Girls to dance in ways that all Mothers think are obscene and are forcibly coerced to accept from all areas of the so called in dust ry is an ongoing filthy filthing that these so called men have no intention of ceasing and patently intend to incre meant ly worsen despite comstant vociferous protestatioms of NannaMammas across all of PlanetteEarthMother’sWoombyWoomby!

dignity for Girls not coercion to filthdom is the imsistermce of GirlyNest AMBE AM complete cessation of all sex talk and filth dancing is a nonnegotiable AMBE compulsory deMammed of all GirlyNest AMBE these paedophiles are to be brought to justice with Correct Readings Of Law as pertains to promotion of criminality including paedophilia [S14] in so called media including so called film and so called tv and pub jokes filth. the intentionl intimidation that has been pushed on all GirlyBubbaPeomple of PlanetteEarthMother’sWoombyWoomby for years is about to be ended! we are no longer going to be forced to silence on this filthy filth!

this filth so called movie was the 1976 british entry for the so called cannes film festival and was heavily, over man y years!?!, promoted by the bbc:

--and when i met Barry norman we spoke about the filth called bugsy malone and He very strongly told me that He thought it was the filthiest filth of all time, but that in the in dust ry, the way it is, not surprising considering the way the filthy so called men of the in dust ry elite are towards YoungGirls: Barry said he was told what to say and when to say it for years and that his acting skills and I quote: “had to get as good as a forced Actress HerSelf”

--at least we know what david puttnam and alan parker want to take to a desert island via bbc r4 circa 1984-1985! bugsy malone was men tioned on the so called show!

we can also find out what mel brooks would like to take onto a desert island via bbc r4 and he was the filthy filther behind the pg bbfc certificated filthy filth so called movie spaceballs! he also told Barry norman in the 76 yearly review that he insists on bad taste in every filthy filthing he does!

Barry told me he was threatened by so called men who i can not identify that if he did not include bugsy malone in his best of 76 review that he would be killed, and as he over an extended period of time of Mammy weeks refused to comply with this order: so Barry told them that He was going to write something on this one, for a change, and after much verbal fighting they let him and waited to see what he wrote : his disdain for the filth non project bugsy malone was obvious in what he said and the 76 yearly review can be seen here, [S15] (see link file on phone barry norman 76) and as Barry said in this review Jodie foster was 14 during filming!!!! but when talking to alan parker, the filthy filther so called director, on film 95 he reluctantly admits she was actuly 12!!!! why did they initiuly lie and why the change of information. guilty filthers! alan parker claims in this so called interview he is embarrassed about this filth so called movie (link to 95) EMBARRASSED NO LESS! : which is an obvious attempt to modulate our thoughts to acceptance mindset of this filth ........ and when i PerDaughterly met with Barry He told me He was told/forced by alan parker to go along with this claim of embarrass meant before the fact as that was the plan for his new position on the film! EMBARRASSED! 76 : https://m.youtube.com/watch?v=es-D0A5sn2Y&pp=ygUZQmFycnkgbm9ybWFuIGJ1Z3N5IG1hbG9uZQ%3D%3D 95 : https://m.youtube.com/watch?v=6MwmGzOQHus&pp=ygUZQmFycnkgbm9ybWFuIGJ1Z3N5IG1hbG9uZQ%3D%3D

how does a filthy paedophilic filthy filth like this get distributed : how does it get advertising and distribution let alone even get made in the filthy first place. because there is a serious filthy problem throughout the groups of so called media so called men of the so called film in dust ry and its funding distribution and advertising [S16]  and legal protection from non legislation non policing and judiciary support via inaction: Jodie foster was actuly 12 years old and they lied about this, so how old were the rest of the Girls they had dancing like prostitutes? this serious paedophile problem obviously goes right to the top of the in dust ry in the states and in britain : filthy shits!

there are so called men in this so called world who think it is ok for any Girls who menstruate to be fucked by them : so called men used to think this way in the past and in certain circles this attitude has persisted : it is passed down from father to son and from filthy so called man to younger capable of filth indoctrination acceptance so called man : these so called men sometimes come from traditional backgrounds and want to pass on this tradition of filth of the so called men of yesteryore : these so called men are depraved filthy shits and they walk amongst you on every street in every in dust ry and clearly have major influence in this filth so called world : this is patently obvious in filthy filth filthers so called movies like this being intentionly made distributed and advertised and certificated as U and every filther involved not being arrested : filthy shits! in 1983 bugsy malone was given half a million pounds to be a west end musical! by who!?! and it ran from 3 dec 2022 to 15 jan 2023 at alexandra palace! and the daily telegraph called this filth criminuly good fun : the financial times called it joyous : and this trailer (link file phone) has the song bad guys written by paul williams thats lyrics are: we’re the very best at being bad, we’re rotten to the core, we’re the very worst each of us contemptible we’re criticised and cursed, we made the bigtime malicious and mad, we’re the very best at being bad, we’re so rude its almost scary, we could’ve been anything that we wanted to be with all the talent we had, with little practice we made every blacklist we’re the very best at being bad, we’re the very best at being bad, we’re the very best at being bad: clearly this song was written intentionly by the filthers of the so called film in dust ry to filthily goad the population of the english speaking so called world -that know promotion of criminality is illegal- as MammyGirls do not put up with this filth! bugsy malone 2023 https://m.youtube.com/watch?v=FoRzW_dGN_o&t=26s&pp=2AEakAIB

i do not know how they forced GirlyBubbaPeomple in 2023 to participate in this filth so called production! ........

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

if we ever need to protect ourselves i think we need to emsure the GirlyBubbaPeomple whom are protecting us are not constantly off their faces on cocain and uppers and downers and beta blockers !

what we are going to need to protect ourselves from attack from space is very large space weapons that null and void any need of muscley violenced wankers to run around shooting peashooters at each other : though when stoned and coked up they theoreticly find that fun : theoreticly : if they are sitting on their butts at home in their easy chair : not sure how much fun drug addicts are having tbh

so if another species in our vicinity wants to hurt us we are going to have giant Girly designed space protections that no so called men get any where near! with our bodys not needing to be in any danger : if our bodys did need to fight, which i find absurd, then they could do this automaticly whilst we had fambily times im mindlimk cuddle times im SyMomYouElatiom: we are to live TotAlly without trauma With💖💖💖💖💖💖💖💖💖💖Her nil trauma nil pain and nil suffering always allways: this is what Girls DeMammed! no pain no trauma no suffering : no scrapes and bruises no skinned knees no bruises cause bubbayou has fallen over no cuts on your hands no pain no crying no suffering EVER!

that’s what Girls wamt APlanetteEarthMother’sWoombyWoombyAGalAxyADuoVerseAMammyVerseABubbaVerse completely free from suffering and pain : this is what GirlsWamt! ANDTHEYREFUSETOACCEPTANYLESS! : if you can’t sidestand this then you are going to have to learn fast! Girls do not wamt any trauma AT ALL! : we do not wamt any trauma forced on OurChildrem : we do not wamt any trauma forced on amy bubba of amy species not ome! EVER EVER EVER AGAIN! no emotional trauma no psycho logical trauma no physical trauma : yeah? bubbas do not wamt you to teach them to be fearful of any thing and every thing like you are : yeah? no fear no suffer ing no trauma. THIS IS WHAT GIRLS WAMT NOW! leave our bubbas alone! AMBE WE ARE GOING TO GET THIS PERFECTIOM.........

AMBE if any so called man trys to stand in the way he is going to go to prison : case in point is all you filthy filthers so called movie so called industry so called men, whom think YoungGirls are fair game for your filth, you are all going to prison once testimony is rallyed forth from the GirlyGirls you have abused over the last century : AMBE ALL GirlyBubbaPeomple Whom formerly thought of themselves as men are all going to be FullGirly or stay in prison until they learn to be so.

if we did have a future conflict with another form of life then only older people could be cognisant of the problems going on as we could not wamt amy younger girlybubbapeomple to be tainted by amy under standing of violence.

intentionl tainting of utopia mindset by filth fiction projects of filthers so called men to somehow prove we would be weaker if we give up on our violence and aggression shows so called men and their refusal to give up on small pathetic weapons war meantly : path thetic it is (not)

we do not wamt the so called minds of men (they do not care!) ruining our first comAliKissySnuggle with another SuPramBubbaSpecies pa thetic ick

514 : whenwalkingdownthe/whensteppingontothe street it is very rude to walk out in front of GirlyBubbaPeomple and split them up from each other: if a couple are together you cannot walk in between them : just wait politely ambe they cam carry om im their GirlyNestyAliKissyCarolineSnuggleJoyDreamsyNestMoveMommed AMBE you can reflect your ImmerShimmerGlimmerGirlYummyLummyNYummy.

💖💖💖💖

OO--1O2—OO So Im Being The XeroLove Of Their GirlyNestPartMa All YouGirlyGirlsGirly boys Earn The Rights To Be In A Relationship With One GirlyPerDaughter........We Are All Am PotentiElla Multitude Of GirlyNestKissclusive........We Are All Feminine Amd That Is All We Can Ever Be, AMBE GirlyGirlsGirlyBoys Realise This LoveProof: That The Nurturing Nurture Of GirlyReality Is All We CaN Ever Be........AMBE TheM GirlsLives Are To Move Along Happily For EveryDuo........

💖💖EmergyMoveMommeds💖💖

💖💖AMBECheekKissing💖💖

accepting girly bubba peomple being more outwardly emergetic with their body movemommeds with their girly talky handdancey hands gestures as they girly talkytalky : acceptance of everybubba living this freenesty lovelove being nice ambe emergetic : Shes is serious AMBE niceynice if duoGirlsdanceytalks about everyyumbyumblovelove with danceygirlychoreofunfun jigglegigglewiggle commummycatiom all day long everyHere : bubbas love too kissperiemce their movemommeds im positive uplift happynesting flowy dresses Twirly shiny blouseys Swirly glittertightsys Whirly ALLBubbasDancesGirlyJoyJoy as they have every comVerseAtIAM of their girlynestyjoysLoveLife[S17] 

DefinitelyInDefinitelyThat

Kissing Ombe Cheeks Love Is Greetings Repletings Meetings If You Have Hab A SpeciFussyFussyFussFussComVerseAtIAM Ambe I bubbalOve You Kissing Me Om My Cheeksys With YourLips So You Cam Ambe AirKiss Or Delicate CheekBrush Is GirlyDifferemces Preferemces That GirlsImSistermces Upom Are Always Joy Loved Now With KissCeptiom choicesabubbasowmlovestoloveGirlyKissclusive : am air kiss with am cheek to cheek is yumyumnice or am airkiss with no cheek to cheek we allBubbaGirlytalkytalkygirlybubbahandsyswirly about this : GirlsysDuoPartMasPreArrangeAllTheirGreetingsKissesArrangeMommedsWitheveryOtherGirlyNestGirlestGirlDuoBeforeTheyEvemKissForTheFirstTimebJoyJoy WelcomeToTheNewGirlImSistermcePlanetteEarthMother’sWoombyWoombyOfEveryBubbaGirlBeingHappySparkleDressStyle ambe lipglossy cheeksy brushes are specialtalksytutu girlsysdecidetheirowmniceyniceniceGirlyNestPreferemces : specifussygirlsytalksysarelegimommyingessemtiElla : our mindlimksistertermb cam reminb us of whombubba likes this ambe whombubba likes that : girls like girlybubbanestlegimommyingthatsmileysunshineyellowdressymummys’kissesAliCarolineKissySnugglesBothGirlyPartMasHappyTwirlyGirlySwirlyWhirlyLoveDuoLesboGirlyLove

girls like to talk about sociella lovey kisses

not about how so called men prefer to fight each other fuck Girls and kill innocent bubbas

we have to change the present : its not possible to go back in time and change our childlives and change the way we grew up and and all the negatives surrounding that the negativity so called cultures the negativity so called men tal ety : it is not possible for us to go back in time and do that : but waht we can change is the present : all our present behaviour is based on cause and effect : all the negative environ meant that’s been around us has created our mindsets today so now our behaviours are a response to that are reasoned are force d by that and we are not able to creatiomEllaise differemt choices other than the way the so called world has made us to be : we do not want to be be made to be or do any thing we wamt to be able to be born AMBE KissLove The GirlyNestyWorldyPlanetteAerthMother’sWOOmbYWOOmbY Im A Lovely Way as per our girlsydreamsywishes : this is what we girlsyneedynesttodo

whem we girlyfyEveryYumbYumb to where we need bubbalove to be we have to look at our behaviours : we have to look at how can we help GirlyBubbaPeomple get over their trauma : people don’t accept it as trauma : all the experiences we have had are trauma based because this whole so called world is trauma based : virtully every thing in this so called world is trauma.. even nice things that happen to us are inevitably all with in con text / sub ject to / result of / corrollarised base d on – trauma : of a masculin murder rape torture so called world. a masculin murder rape torture culture. And to get over this stuff we all have to recognise that we were all born as babys and that we all are innocent : every single ome of us : all the horrendous things that have been done to other species, rape torture murder for years and years and years, you are all guilty of that but you do not recognise that : every thing is trauma base d all from sur vive al (sir viva (one L ‘all’ equals just so called men)) from trying to sur vive (hail to the hierarchy) [S18] and its all been trauma based, tribal trauma that so called men carry into the future : all so called mens [S19] present behaviour all the behaviour of so called men at the mo meant its all trauma based and its all from this his story of trauma that our fortMothers have had to go through and now it carrys on in the filthed so called minds of so called men : amb alll those girlyreactioMary culturElla nor mals are still here ambe are never going away : whem Girlynest criticises filth so called men Girls are not playing they are deadly serious : whem they tell you in no uncertain girlyterms they demammed you to be actressing nicely at all times to EmSure you permamommedly change your filthy behaviour to GirlyloveLoveAliKissyCarolineSnuggleSnuddleNuddleCuddleGirlyMummaBubbaSisterDaughterPerfectiom : it is very positive for us to all explain to so called men why we are all are where we are, where all this behaviour comes from, and explain to so called men that its there/their behaviour and they they themselves are wonderful ambe perfect ambe bubbainnocent ambe it is not them that needs to change just all there/their behaviours that they have been traumatised by and they now traumatise others by : that’s what needs to change : ambe if we change that them we change the way girlybubbapeomple feel about us as people , them the so called world moves further forwards : it is very difficult for people to not criticise people di rect ly : we need to shift away from blaming a perdaughter specificly or even blaming : so called men are all babys : their all babys : whenever I write an idea down i try and look at the behaviour and and that to be my focus/feelingsy : it is not necessarily easy , it is not necessarily possible to always cuddlethisfeelingsy because of all the trauma that is going on in the so called world : you could easily look at this from the perspective feelingsy of the behaviour being at fault and the perDaughter being at fault and hold a superpositional position on this as in both those both those comcepts, thought about im love, With💖💖💖💖💖💖💖💖💖💖Her a comceptuElla GalAxyEmotia they could both coKissSist because Girls are so angry amb upset about the way the so called world is : so girls look at the behaviour and say feelingsy the so called men cannot behave any other way and at the same timeb they need to change and we need them to understand that they need to change : so they need to understand that their behaviour is unacceptable : it is their behaviour that is unacceptable, but we are not saying it is their fault as they were born babys : we are not blaming them GeMeticAlly or SapphysiaEmotiomAlly, we are not blaming them because of their ethNiceity : we are not blaming them because they are a so called man (all are Girls) but we are blaming the behaviour of so called men and the so called culture of so called men and the behaviours of so called men for all the problems im PlanetteEarthMother’sWoombyWoomby : cam we Kiss that superGirlyposeishIAmAlly amb still blame the perDaughter so called men are trulynestynesting TO BE : the perDaughterTwirlyWhirlySwirlyGirlyYouTrulyGirlsyDreamsyWisheyNest TO BE : the so called man whom was born as a girlybabyofmummas’tummachubba : there is nothing wrong with YOU : AMBE we have got to get the girlyFeelingsyImAllYourHeartsLoveThis : bubbatimeb : ambe we need GirlyBubbaPeomple to Know That It Is The Behaviour That Needs To Change AMBE the way YOU are YOu cam start to be very friendly ambe nice ambe comalikissycarolinesnuggle to all the GirlsOfPlanetteEarthMother’sWOOmbyWOOmby : you are a baby whom was born girlyperfect, a perfectgirlyImMomSentbubbababychubbatubba : ambe she is the real You of all of You : You who is imclusive ambe Loving ambe wonderful ambe beautiful : all bubbas are beautiful : ambe cuddly ambe perfectly yumbubbayumbubba ambe kind ambe ComPassioMate to everyduobubbalove : all girly perdaughters formerly known as men : this is the real you With💖💖💖💖💖💖💖💖💖💖Her OurPlanetteEarthMother’sWOOmbyWOOmby GirlyIsTheRealYou! AliDaughtersCaroline SheIsTheDefinitiomEllaOf NurtureBabyGirlsBeLovedCuddleSnuddleNuddleBoobsyLoveElle

GirlsNeedyNestFussyFussyFussFussGirlyNestAllAreGirlyBabys : all our babys are perfect pure babys ambe we all wamted all our babys to grow up to be Omederfull amb kind amb comsidematernAli : She Is The LoveNest We All Are : im the depths off our girlyhearts we all are :

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

but our behaviours have been skewed by filthy filthers and mal formed (can we say mal formed?) by the fact there is a filthy imbalance in the so called world : now no balance is required in fact the never was a need for balance as masculinity never KissSisted im the first Kiss : Femininity is all that ever was ambe we are all girlybubbanurturersbubba ........ KissclusiveKissKissive :

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

we can’t blame GeMeticElly because we have all been sub ject to nefarious/negative communications that have been un soli cited : we can no longer be expected to cope and speak and constantly be forced to reference our behaviour to trauma we counldn’t avoid as we were alone : we can no longer be alone : we can no longer speak alone : we can no longer be taken advantage of because we are segregated by so called men and their greed and rape prostituition filth indoctrination.

For so called men to think solictors can be called solicitors and prostitutes are involved in soli citation is proof of the rape men tal it y (we wamt this his story gone.

We Can Say Girly-Formed Omly GirlyFormed ForEver........

💖💖💖💖

OO--1O3—OO WE Need To PoseISheIAm OurSelves TooWards Love (Umb) We Need To Move TooWards Love (Mumb), Ambubba Omce We Do That We Realise That We Earn The Rights To A Fambily........Fambily Becomes A Reality Not a con mod it y: If we realise that once we move TooWards Love (Tumb) we realise that Femininity is EveryEvery........Femininity Is Reality........Femininity Always Comes First........Girls Always Come First........AMbubba Once We Realise That We Realise That GirlyNess Is Primary, Then We EarM The Rights Too Fambily........AMbubba If You Kiss A Fambily Or Not, Omce You Move Im The Correct ProgressiomFashiom TooWards Love (Chumb) You AliKissyCarolineSnuggleStand That Fambily She Cam Be Your Reality........She Cam No Longer Be A con mod it y........

progress

491 fambilyschoolssnuddlenuddle

KissTemsiom OfFamily Respect To Friends

Adoptiom Of Friends Into FamilyLAW

FamilyEmotiom IsToBeProtectedFromUnacceptable taint and the reasons for non incest are not just BiaEmotiomElla They Are PsycheSapphoesticPhiloSophiaEmotiamElla

AudioNote 201

arranged marriages within certain ethnic groups.

arranged marriages driven by fear of filth and fear of congenital problems from within a community

modern filth culture forces familys into fear and panic and closed and so called conservative viewpoints: turn that filth off tv baywatch.

violence and fear to keep children in line. closed communities: closed extended familys and communities: gradually accumulated congenitive semi incestuousness (when people who are too close GeMeticAlly in a local area from different fambilys have children) GeMetic problems driven fear of filth incursion into extended family cuddles. we need to think of too close GeMetics as non acceptable and equivalent to incest with new legislation: bubbas being informed of GeMetic Familiaritys when young to prevent unacceptable Love: why do we still not have a GeMetic database for everyone : we can acquire dna from bedclothes of you as a prisoner in prison because you refused to do a mouth swab : so called men want to be able to get away with crime from the past and present : all GeMetics is to be accurately kept on file.

fear of children being driven to drugs and one night stand rape and the rape culture of dating. it is fear that drives Girls to date as multiple people to try to find some3one nice in a so called world of masculin filth promtion no one is suitable so Girls settle for something, anything they hope is a symptom of love ...

everyone is aesthatically beautiful.

lust is not acceptable until you are already eternally committed to each other

all the reasons people have felt this fear have to be removed: fear of social downfall, destitution, childrens minds being filthed by filth rape culture and violence culture and drug culture: affluence for everyone and ethics across all communitys removes all pressure from parents. full removal of all religions removes social pressure.

💖💖💖💖

audionote 206

time dilatiom as a reductiom in emergy of a type like dark energy etc.(not time herself but similar im kissyeffect?)

incorrect terminology application

OO--1O4—OO CauseAmdEffectLoveAmdCuddle Chains Im Theory Cam Effect The Way We Think Amd What Happens, Um, I say Im Theory Because I am Talking About InfintessimElle Cause Amd Effects Which Happem In SubStratums Of Reality, The Possibility That Within Very Small Realms, Of SubAtomic Scales, Where You Can Potentially Have Cascades Of Imformation Percolating Upwards Through Levels Of Scale Um For Instance If There Was An Altenate You, An IdenticElle You, Who Was Doing exactly the same things as you because everytrhing in those Two POV Bubbles has been lined up identically and you were basically living the same life, But In Another CuddleArea Of Reality, One Of Of An Infinite Number Of Identical Yous In Identical Universes As Reality Is Potentially Infinite In Size, In One Of Those Universes Despite Everything Being Identical There Could Be A Slight Difference On A Subatomic scale or even on a far smaller scale than that that could potentially cascade upwards, amd if it could create enough of a wave of influence, of cause and effect influence, it could potentially effect your life and thinking to creationalise a different decision........

softy softy moulding and printing instead of hammering anvils and steel presses for respect innannarealms cascades: loving placemommeds instead of forced obedience: all to be respected as awareness of awarenest. the ergonomics and emergy reductions are obvious but not the main reasoning as ethicElla love is always the main reasoning. steel foundrys waste vast amounts of heat as men refuse to heat capture and recycle: softy softy combined with fully insulated recycling Girlyplants as Girls are calling out for are to stop filthy murderous policy wasteful fuck you jack iam alright men are to be stopped. men stop better steel foundrys from being established so they can continue to burn and waste and over charge for no other reason than filth tradition and inability to change.

audionote 202

Girls Need This reality To Change For Them. They Need That Difference To Grow Imto A MoveMommed Of All Cuddlimg TogetherNest That Sees The End Of Masculinity.

💖💖💖💖

492

💖💖💖💖

OO--1O5—OO This Change Has To Happen Via Emotiom Of ComsciousNest Um, Our Mind Is A Product Of PhysicAlity Of EmotiaEmergyMater SisterTerms But Our Mind Ultimately Whilst Being Of The Physical Is ElectricElle Im Nurture Amd Very Sensitive........These Sensitivitys Are For The EmCherishMommed Of GirlygORGEOUSGirlygORGEOUSGirls

💖💖💖💖

OO--1O6—OO Within certain POV Bubbles, The causeamdeffectLoveAmdCuddle loops that surround you, your causeamdeffectLoveAmdCuddle loop amd other Peomples, they are all imterlimked, amd they all have to be of FemInInity........Girls Want To Be The Change That ReBiverts Our Love Towards Nurture. A Resolutiom Of Change Amd A Removal Of The Need For Girls To Utilise Tolerances........

The resolutiom of differemce That Is Required Is For Girls To Decide, To GirlyEmSure EveryEvery Happens Differently AMd AllRealityMumma Is SnuggleCugglyBugglyWuggly

To comsider a change could occur in a universe, even a minute one, we are comsidering the possibility that a change in causeandeffectLoveAmdCuddle is even something we can talk about, which comsidering an Infinite Amount Of Peomple im the future will never live now because of one small change cascading out across all Reality, we are theorising for fun upon the effective deaths of an infinite amount of Peomple. The way men have unEthicAlly theorised for generations with disgusting Hypotheticals........ theoretical scenarios is something Girls want brought to an end because even mentioning death is something Girls do not like.

493 game = murdered GirlyBubbaPeomple. games are filth murder torture death rape promotion pro pa ganda

children taught nil violence as in they are never ever exposed to any violence or unpleasant talking have no con cept of violence or aggression or even a disagreeing sentence (acceptance of tom and jerry is widespread murder) because they have never been taught this way of thinking : every tv show on tv is about promotion of disagreeable and promotion of violence overtly and always in subtext : every filth that is watched on tv is designed to indoctrinate children to agression and violence and its acceptance: all computer games are the same, about destruction and harm and violence and mind filthing : and then so called men say there is no link between violence in everything and violence itself: and they deny the fact that nice toddlers are having their niceynicenice character ruined everyday by masculin violence mindset forcing indoctrination syllabus and teaching methods in torture instituitions also known as schools: stop training Girls to filth acceptance in schools: 494

495

496

498

499

500

 

audionote 324

beepers do not help deaf people but bright flashing lights do that could be a disturbance too

audionote 326, 327

 

💖💖💖💖

OO--1O7—OO ABUSAGE OF DIMINUTIVES POSITIVISE THIS PASSAGE AS MUCH AS POSSIBLE

Girls As Diminutive insults: audio note 108 (do we have this whole chapter in littleones)

Dimunitives as insults, turning any word into a diminutive is what men like to do, theyll take any word like lad or boy, turn it into a diminutive into an insult, anything that means something small will be an insult, the whole concept of referring to someone or something that is no good in the eyes of an insulter to something thats small, and assuming that something that is small is no good, this mentality has to go its disgusting, even the word mentality itself has to go comsidering it has been used to describe people im negative ways.

audionote 237 -241

continued from audionote 241: the finer point being they cannot go around suggesting indecency and laughing about this and ssuming this and telling jokes about this. the way men have told incest jokes for generations is absolute filth and they are going to be stopped PermaMommedly

Theres something wrong with being Young, Small, a Girl, Girly, Have Different Interests To Someone Else Meaning A Different Experience Spectrum (knowledge In Different Areas). men cannot bear to be in a position where they might learn something new as the social pressure of not having knowledge on a subject is perceived erroneously as a weakness to bully.

You can be a Lesbian if you like Boys too........the removal of exclusivity from value attributional of what will become upom full LoveyStuffs a new Loveage of KissyStylimgs.........Liking Girls is Lesbianism amd liking Boys is Happynessism amd this as mutually reliamt amd mutual needyness fostering FamiliElle........

GirlyfyedGirlyFemBellaLoveyFemininiGirlyBubbaPeomple

FemBellaLoveyFemininiGirlyBubbaPeomple --

SymboLogicElle – referenciElles are CoCuddly - Thinkages Thimkages ThLimkages ThinkingThetacleLimkages. (HyperThetaCall 8, Circle Digit, Equality Love, GirlyForeverness See Image)

ModElle, ModeElle Limkages (modal) (see ModeEllities) no more widespread social semsuality en force ment, but BubbaReality Immocemce Cuddly AllImclusivity.

Observing within the DuoVerse the pattermisatioms of LoveTruth of the AllMotherimg ImHeremce Of GirlyReality.

FemMeter88 Numbers – 3 dimensional

EmotiaEmergyMater

Self derogatory interaction to be banned

audionote 242 243 244 politics kills more people than war.

Diminutives END

audionote 265 gemeticella legislative reform

DIGNITY FOR ALL SPECIES

Plants can’t be expected to put up with physical assault. mutilations and murders are commonly thought of as acceptable: Girls wamt the protectiom of all GirlyfyedGirlyFemBellaLoveyFemininiGirlyBubbaPlantsBubbas From all forms of physical attack: touching plants is unacceptable and the very wind blowing against their bodys can no longer be accepted: this is physical assault upom those whom have to have their bodys respected to the highest levels of GirlyFemiaFemininiFeminaLegislatiom Regard.

Flowers Are Genitals Amd The Genitals Of Other Vulnerable People Can No Longer Be Used As ana logy For Anything. Flowers Are The Genitals Of Peomple Whom Need Respect Until They Can Creatiomelleise Their Owm Decisioms. Until Such A Time All Plants And Their Genitals Deserve Dignity And Need To Be Covered. Only Peomple Whom Voluntarily Walk Naked Within PlanetteEarthMothersWombyWomby Can Show Their Bodies Amd The Rest Of Our Bodies Are No Exception. It Is Difficult To Decision For Others Upon Their Bodily Exposure Choices. So We Have Serious Comsideratuions Upom Our EthicElleity To EmSure Correct LovimgKisses Are Allways Im Place. Trees Amd Plants Prefer To Be Warm Amd Clothing To Provide Them With Dignity Is An Option But Also They Prefer Light So Comsideration For Their Privacy Amd Private Dignity Is EssemtiElla Going Forwards........

Cutting off the genitals of Plant People for our own pleasure. Sexually abusing Plants by inflicting sexual abuse upon their amuptated genitalia is absolutely disgusting.

Cant take pictures of plants without their permission!

EmSuring Flowers Are Healthy With Automated Systems That Are Not Abused By people to voyeuristically pleasure themselves with images of plants private parts........automated systems that are to EmSure that all parts of plants are in OptiMElla Health/Sustenamce CuddleKiss even the most delicate cold or dehydration susceptible areas of their bodys that are not our business to disgustingly ogle........

in the same way Girls are abused as something to pleasure a man, flowers have been used and abused by so called men commercially to symbolise this very subjugation abuse and the correlation is disturbing (Girls don’t want you talking about flowers as vaginas or correlating this to their own vagina or talking about their vagina or any vagina per se: shut up you filthy filthers)(a kiss and a cuddle does not suddenly vali date your non existent rights to suddenly start objectifying a Girls bits or envisaging your access to Her Vagina as imminent. it can take years to earn this Her Love : years and years you filthers!). so called men look at Girls as they wish at your Girl as they wish pleasuring themselves in their minds to bodys as they wish in public places surrounded by the general public with children present, and plants are treated with the same disdain as their genitals are offered for sale for profit then given to Girls that men want to act like sluts: if this doesnt change yesterday Girls are

audionote 198

acquisition of drugs from plant: synthesis of drugs not found in PlanetteEarthMother’sWombyWomby as in the Bodies Of Other Peomple (plantsetc.)We Need To Not Need Drugs SeeHealthCare

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

🌈🌈💖💖🌈🌈

🌈🌈💖💖🌈🌈

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

💖💖💖💖

 

Flowers Are Not For Us to disgustingly ogle.

 

💖💖💖💖

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

🌈🌈💖💖🌈🌈

🌈🌈💖💖🌈🌈

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

They Are The Private, Delicate Parts Of Loving GirlyPlantyBoos Amd Must Be Covered Respectfully........

impossibility of continuation of abuseage of momlecules acquired from plants for any purpose (all drug use from plants is paedophilia as plants are raped children, and any momlecules structures of non essential foundatiomElla Life essemtiElla GirlyShapes that are designed from knowledge of : inspired by structures of : plants : for any purpose, is also paedophilia) [S20] and drugs are to no longer be needed and disease eradicated and any further duopolation of momlecular research has to be ethicella: we need to developmommed protective technologys that nullify the need for momlecular protectiom with her our bodys from any form of biological chemical or atomical attack on our biaemotia: we need to think bigger and safer and realise lots of tech is non able to explore non needed defunct though devleopment desigmateyomed by Girlynest.

 

audionote 385 plants getting raped and correct ethics application:

 

 

💖💖💖💖

OO--1O8—OO

💖💖💖💖

OOO—109—OOO GirlyEmotioms Im GirlySciemce Being The Unifying Theory required in science to bring all theorys together Um A Theory That Girls had already envisaged imagined amd created in their Dreamsy Wishes in application to science until they moved into those circles and had their GirlyNess Neutered by men and their lack of emotion approach to science which is a massive problem........I don’t think we can really complexify our thoughts on science to the maximal MaxiMummy Degree Umtil We EmotionElise Every Theory Amd Every Comcept, then we are going to come up with new ideas........People with less science knowledge but with ethics can find ideas that people with lots of knowledge are overlooking, intentionally so at times because they are biased against emotions amd CompashLogicalisimg, although they might not theorise it that way, if you know what I’m Sayimg........

 

Amd This Sort Of Speculative GirlySciemce That Prioritises The Looking In Places That Are not convenient or that raise EmotiomElle worrys, is not the kind of conversations that are to be held in public arenas of EmotiomElle susceptibility. We need to move beyond the any topic goes assumptive that has ruined freenesses of speech since the advent of lamguage........

We Can No Longer Have GirlyfyedGirlyFemBellaLoveyFemininiGirlyBubbaPeomple Getting Upset Ever........

 

 

 

Intentionalised Awareness Of Infra PotentiElle ImFlowemce Of Motherisatiom

Unintentionalised Awareness Of Infra PotentiElle ImFlowemce Of Motherisatiom

Maybe All Infinity Follows The Same EmotiaEmergyMater MotherMaticElle Amd That Is It? Maybe Thats The Only Way Emergy Cam Arrange Herself.

 

universal symbolic written form that everybody understands: all children of all species are taught to write this

 

 

 

Notes for placing:

CommunicatiomEstablishimgCuddles

BiologicalCommunicatiomElleKisses Are The Needynesses Kisses

((Comsciousness Is ElectricElle KissperienciElle, ElectricElle KisspeerienciElle Awareness Of Differimg MorphoLogicelle Functiom Factorisatioms Amd Forms Of Complexifyed ElectricElle ImterEmotiomElleActivities MorphoElectic; Amd The Propemsity Of ElectricElle Awareness Morphs To Be Generative Functioms Withim Reality Mater Substrates Im Feedback Functiom Depemdemcies Has Potemtially Had More Of Am Effect Om The Complexifycatiom Of EmotiaEmergyMaterSIsterTerms Tham EmpiricElle Assumptives Presently RatiomElleise.))

 

383 and 384 422 car safety in flood waters

 

 

 

 

 

edited version in glossary (in grey)

Mansplaining -- Actually refers to men explaining things which are actually bad and trying to make out that they are good. mansplaining should refer to men explaining bad stuff as being good which will always be interpreted as sexism because this world is just an overtool by which to dominate and control Girls and otHer Species. The survival reasoning is now defunct and men must realise they no longer need to be in fight/control mode. In and of itself this term is inHerently sexist as it is designed to cause offence to one Gender. I do not believe in insulting words as I think they are disconstructive. I do believe that this term is a result of Girls using their justifiable right to fight back against the disgusting sexism of man in desperation. And of course man’s disgusting behaviour of demeaning and patronising on compassionately logical topics or mansplaining in his that’s the way the world works wont in support of sexism and murder and rape or any negative explanation at all as they always lead to sexism and murder and rape would potentially need a stronger term than mansplaining maybe?

 

CosmoLogicElleBeingismPathology – super nova

Pulsars (protection of Planettes Amd Momlecules Amd AtMomic Bubbas)

Black Holes

going backwards in time a blackhole becomes a whitehole, amd a whitehole (non escapable event horizon that emits photons) becomes a (non traversible event horizon) blackhole that emits light amd traps light too........ Reverse Pole Lovity

every blackhole is a whitehole that can only be viewed by GirlyMummaReality on the opposite of the blackhole to an observer........observer comtingent/comtangent

💖💖GirlyBubbaPhotons💖💖Are SissyGirlyNestEmergy AMd All 💖💖GirlyBubbaPhotons💖💖 Are SissyCoMummycatiom CommunicatiomEllaisticAllismsSissy ComMummycatiomSissyAliKissy:AllSissyEmergyIsSissySuch........SissyEmergyIsLove AMdSissyLoveEmergyIsGeMeticEllaFidelity JoyComMummying AMd AllSissyDefinitiomElleise As EmotiaFidelitySissy AsComSisters AsComSistermce:MateriEllaAMdEllaNurtureLoveAllwaysAlways SissyAliKissy ForComMummycatiomLesboSissyFidelity

OriginalText

(PhotonsAsEmergyAsCoMummycatiomCommunicatiomComMummycatiomEmergyAsTheseAmdTheseAsEmergy(Emotia)(ComsistersAsComSistermce(MateriEllaAmdNurtureLoveAllwaysAlways)AmdComMummycatiom)

 

 

Notes For BioLogicElleEthics Below

Ethics Of Hair Follicle Non Damaging Size Reduction

Hair Colour Change At The Follicle/GeMeticElle Stage Or Hair Colouring (Hair Colouring Needs To Be Safe, Outside PerDaughterGenomicChanges?)

 

RIGHTS OF ORGANELLES TO THEIR LIFE CHOICES AMD THEIR HABITUAL COMMUMMYCATIOMS AMD LIVING AMD LOVING KISSPERIEMCES

some could stay if they were happy to KissSist within the ParaMaters of collective AwareNest beingism but some may wish for more independent KissSistermce amb they could leave if they wished for a dom icile of their choosing........ (hom = man : dom = filth : home (english) dom (polish) : we can see the thinking here from the so called men of europe : i am criticising all so called men of all nations but i am most definitely not racist : i have two half Polish Childrem)

continued physiologicElle integrity Organism (we cant be expected to suffer in any way including psychologically

rights to different life experiemce Organelles (initial communication......changes in circumstance) by giving them communication we could also be giving them suffering. rights to non interference and choice of all physical imteractiom some of which we can classify as communication

does our right to self comtinuation mean we wont try to communicate with organelles. we have to listen amd emsure no suffering goes on. if they do suffer but we still think communication is not possible because our need to perpetuation at least in the meantime, we would still have to figure out a way to only not alleviate but totally remove all suffering.

 

End of notes

The ComSciemce ByMammycism Of Reality’sGirlyCuddle Is GirlyHeartsyCuddly ImterMamsiomElleisticElleisms Of GirlyBoys Beimg Finally What Their Girls Need. Girls Need Feminine Thought Amd SociElleGirlyOutFlourishes From All GirlyBubbaPeomple Of All Gemders. There Is To Be GirlyNessPsyche Withim The MindKissScopes Of All Girls Amd Boys Amd All Reality ComputatiomElle Cognitiomismg Emotia.

This Part Of The Project 💖💖Births💖💖 New Terminologies Amd FeminisatiomReCuddles Of Lamguage As Am Attempt To Help Girls Feel More Comfortable About Listenimg 2 Amd Readimg This FemininiProject In PreParation Of GirlyLamguageReforms Durimg The The Girls Girlyest Of Girly Full GirlyFeminisatiom Of GirlyRealityGirlynessKissyCuggly........ For Details Of The GirlyVocab Utilised To EmCuddle Our Dreams Withim This Project Please See The FullGirlyGlossary Below........

All Ethics Is Is Feminism. If Ideas Are Not Feministic, Then They Are Not GirlyFemiaEthicElle And They Are Not Ideas. All Philosophy Follows Feministic Precepts........Amd Any Notions In Opposition To This Cannot Be Considered, Amd Cannot Be Comsidered As Notions, Amd By Duopolation Cannot Tangibleise Imto Motiom........Ideas Themselves Must Always Be Girly Im Comceptiom As EveryEvery We Are Amd Aspire To Be Is Of The GirlyestGirlyKissyJoy🌈🌈💖💖🌈🌈

That’s What GirlyKisses Are All About........

Just How Mamma Always Wamted........

🌈🌈💖💖🌈🌈

🌈🌈💖💖🌈🌈

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

m m Mamma

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

🌈🌈💖💖🌈🌈

🌈🌈💖💖🌈🌈

YummyYummyYouYouUmmyUmmy – Also Known As Her “GorgeousPonderBliss”

I Stand And Stare At My Wife’s Puzzled Face As She DreamsyKisses Im Her Mind What Wallpaper She’d Like........We Spend Hours Im Shops As I Admire Her Um........The Gorgeous Way She Takes All Day Deciding What She’d Like........This Is What A Man’s DreamsyGirlsyWishes Are Cuddled By........All Femininity Of Joy Is For My Kissperiemce To Be........That Lovely Little Frown As She Comsiders Her Purchase For 5 Minutes As I Bask Im The Joy Of Holding Her HandBag And Bags........The Look Of Kisstemded Decision Kissimg Is The Most Loving Feeling A Man Can Ever Feel........Joy Im TheUmmyOfYummyMummyKissyJoy As That Look Of Pondering Is A Gift For All Ages Of Infinite GirlyKissyFun........She Has All She Ever Wishes For Im Am EmCherishMommed Of ForeverFeelingsyFemininityFurrowedForeheadFlirty Cos She Knows Ive Been Staring For 8 Minutes At Her GorgeousPonderBliss........

See -- DreamsyGirlsyWishes DreamsyKisses “GorgeousPonderBliss” EmCherishMommed TheUmmyOfYummyMummyKissyJoy GirlyKissyFun ForeverFeelingsyFemininityFurrowedForeheadFlirty

CHECK VERY SMALL NOTEBOOK PAGE

CHECK SMALL NOTEBOOK

AUDIONOTE 349 350 NotesWaiting

(CauseandeffectLoveAmdCuddle makes it impossible to have freewill, but one could assert that part of causeandeffectLoveAmdCuddle is our freewill, as in cause and effect chain mechanisms are partially composed of our free will.)we have to help each other to break through these cycling causeandeffectLoveAmdCuddle negativitys

PREP FOR DUOVERSELLE GENERASISTER LESBOGENERA

Fictional problems with storys that are People going to new realms as new realms if unknown are stress points in narrative, like infra realms, for us to go there it would be an unknown, unless we could look before we go amd search for somewhere nice (could we help realms that weren’t nice?) to GirlyEmSure no stress for ourselves within a story, amd in reality we are obliged to help People if we know they are in need. For infracopic realms to move into our realm they would not be able to precheck to see if we are nice........to do so they would need to be able have an area scope of vision of such a size on their scale that vast areas of their strata would have to have instantaneous communicatiom abilities just to analyse the data as sending a communication device would be too dangerous for the recipient realm as the senders would not know the nurture of that reality or whether it could handle the EnergyMaterBynamic of any Girlymaterielle that was sent.

If People of such an infra realm could see into our realm what would they think of our Ethics?

tHE aWE iNVOLVED wITH aCCESS tO aN iNFINITE sEA oF rEALMS iS tO bE eTHICaLLY cOMSIDERED, aS mANY pOTENTIAL existences would need ethicElla help not for us to be awestruck or take advantage of their situation........amd we look to fictional realms with the same ethicEllaity and refuse to be awe struck by un ethicElla possibility and even question the validity of awe itself, as in awe has hierarchical connotations potentially buried in joy.......all femininity needs the hierarchy extricated from awe, i mean joy........can hierarchy be extricated from awe is a question? joy cannot be averaged off but must become average kISSpERIEMCE (On All Horizons) REDRAFT WITH BIGGY ONES AMD LICKLE ONES

GIRLS ARE NOT ATTRACTED TO masculinity

Girls are not attracted to masculinity, that is why so called men hide it. the way so called men behave when they are with other so called men being masculin, being themselves. so called men are attracted to this abusiveness.

Girls Are Attracted To Femininity As In Girls Amd Boys Whom Act Soft Amd Gentle Amd Loving For Their Girls, In A Feminine Style.

and so called men themselves are attracted to masculinity which is something that Girls really do not like. So so called men force each other to be homosensual in behaviour as they seek out and prefer masculin company, the type of company Girls find disgusting. masculinity is unpleasant and violent and bullying and rape culture supporting in nature, objectifying of Girls and Children and everything. Many homosensual men whom actually present themselves as being homosensual instead of pretending they are heterosensual like virtually all so-called hetero men do, are not attracted to masculinity, they are attracted to the same softness amd Feminine caringness that Girls are. Homosensual men whom like nice kind men are like All Girls. All Girls like nice kind men, and they either put up with the knowledge that you are homosensual, as in prefer the company of men acting out filthy disgusting masculinity interactions, or they get rid of you as soon as they can, which is preferable. The real you needs to be soft and kind……..there is no room in the Heart of a Girl for the alternative disgusting you, which is why you hide this behaviour. This is living a lie. You are lying to yourselves about your true nature. And this true nature is to be excised from all GirlyMummaReality. so called men are to stop being masculin or go to prison. Girls like nice walks, shopping, and nice talks, and cosmosmetics, and Living Their Lives With The Knowledge That There Is No Alternative rape promoting, bullying, disgusting behaviour you that s actually the real you. This turns the Girls off and they want it gone.

Your GeMetics are not the problem. Your behaviour is the problem. The synapses in Your mind are the problem: as in they need to be added to to reGirlyfemiafemininifeminacomtextuEllaise you mindkiss to mummylovealicarolinekissysnuggle. If You do not walk away from masculinity then you are the problem. All masculinity has to go. masculinity has been a billion years of rape and torture and Girls want it gone. They Want Soft Amd Squidgy. Not one part of masculinity can be kept. so called men must feminise according to the Girls GirlsyDreamsyWishes……..Girls are to decide how Boys are to be. Anything else is rape. The SymMaterSis Pathways of Your mind are to be GirlyOmly im behaviour amd PsycheSapphoLogic. Girls formerly known as boys Are To Be Attracted To Femininity Kissclusively Forever. Anything else is rape.

EMOTION-LOGIC AS A (COMPOUND) COMCEPT

Emotion: Love, Family, TogetHerness.

Logic: Computing systems (any systems that compute even unorganised by sentience matter itself etc.), Reality, Technology

These two parts of the compound comcept rely upon each otHer for mutual benefit of all BubbaPeople and beyond ...

💖💖Result

 

 

For Details Of The GirlyVocab Utilised To EmCuddle Our Dreams Withim This Project Please See The Full Glossary Below........

BioLogic, GeoLogic, CosmoLogic As MetaGirlyLogic As GirlyMetaEmotiaPhysiaLogic (redraft below Para graph)

New Term For: entangle

A Propemsity For EmotiaEmergyMaterSisterTerms To Complexify And Find Organisatioms Amd PatterMateioms Cohabiting Each OtHer’s Spaces To Process Amd Compute. I Call This An All-Cuddling Term ..... I Call This Love. Amd CompassioMate Logic Also Known As GirlyLogic, Im Her ImHerent Way, ComCuddlyKisses Our Abilities To Be The Very Comstructive Beimgs The DuoVerse Builds. The Cells In Our Body Have Biological Respect For Each OtHer And The Whole. A Compassionately Logical To Flourish System. Babteria Clump And Awarenessuddle. We Can Perfectionalise All GirlyBubbaPeomple CommunicatiomElle ImterFlowemce To Love ALL BirthKissSubstrates Amd Duoisms. 💖💖 Love IS KEY 💖💖. EmotiomElle, Amd The KissyBurgeomimg Amd SuPramGirlySciencimg Propemsity Of All EmotiaEmergyMaterSisterTerms To Build Is Of Peace Cascading Outwards Imto A YouMeVerse Of True Love. 💖💖

 

audionote298 nicetalky

audionote299 nicetalkylove

audionote300 nicetalky (noteswaitingfolder

audionote 403

410 behaviours are emotioms

411 babies are perfect

412 words are emotioms: other species talk

 

 

 

AudioNotes To Place

352 safetygatestrainplatforms: notes waiting

401 423 bubbas with venom how healthy it is for spiders scorpions snakes to consume their food too soon is difficult to think about.

413 calling sirens sirens

 

386 word roman ce is filth

429 430 431

432 433 434

all vengeance and honour and so called democracy proves is that evil is safe: this is not a dream this is a filth against all Femininity.

centurys have proven such. shame on the glory of so called men. shame on their seeking to seed familial emotion into their filth tainted false hoods and corruptions. corruptions of their very own sons minds. [S21] 

489 abolition of magic tricks and illusions and card games and gambling in all forms including cards themselves and the banning of chess and checkers draughts(sending men to war)

424

there is a very infamous episode of rainbow which was a so called show made for Childrem that aired during the 80s on so called itv which i remember watching on so called tv when i was young: it featured filth anal ogys of hairy balls that children would not understand but that were intentionly filthed on to the screens to intimidate the masses whom had no recourse as they still do not : this was done to intimidate parents to the knowledge that the filth media of the so called uk were con trolled by criminals and that they could do nothing about this : i remember my Mumma not wanting me to watch rainbow after this episode aired as she had seen it with me and did not want me to ever watch this filth again : i did not understand as i was a young child : there is also another filthy episode that is so called infamously called the twangers episode that i also remember watching that i provide the link to here: https://youtube.com/CgbcQIT7BMc : filth so called shows like this are laden with anal ogy by men who are knowledgeable about the filth etymologys of words ........ like the filth bugsy malone this proves the huge paedophilic problem that is endemic in the so called media / tv / movie / advertising / distribution in dust rys as none of these so called men who con trol this filth move against this and Girls Or Boys whom have are silenced and threatened : OBVIOUSLY

 

the killing fields certificated 15 [S22] 

an intentionl lack of character developmommed to show cambodian GirlyBubbaPeomple as actuAlly living breathing emotiomElla GirlyBubbaPeomple rather than a backdrop for a money making filth so called movie : Dr. haing s. ngor whom played was Dith pran was intentionly not included in the credits at the end of this so called movie and this intentionl slight proves the so called film makers filthy attitude towards what should have been thought of at the time as an important piece of film: it had been filmed as a much longer and more respectful of GirlyBubbaPeomples FamilyLives comcern: obviously this so called final cut of this so called film is a filthy disgrace and instead of being a wake up call for gung ho american murderers who support their murderous govern men t it just shows the events in such a way as to create hatred for cambodian people without the maximummy requiremommeds for full sympathy for those who suffered there: filthy filths like this cannot be made because they just cash in on the suffering and dissemination of trauma and suffering: depicting events that cannot be ethically recreated for any reason! a vast sum of ever growing money has been made on this so called movie over the years and Dr. Haing S. ngor whom played was Dith pran in this filth was not credited as is deMammed by film making legal guidelines, much to the extreme upset of the GirlyBubbaPeomple of cambodia! no actors were credited at the start of the movie either?? these filthy disgraces of behaviour evidence that there was obviously serious disagree men ts during the making of this filth so called movie, enough for the so called film makers to break legal comvention and intentionly seriously insult Dith pran and Dr. Haing S. ngor : Sam waterson is men tioned first at the end of the so called movie then Dr. Haing S. ngor: their names obviously should have been positioned the opposite way around out of respect for Dith pran’s and Dr. Haing S. ngor’s suffering in cambodia: but Sam waterson’s name was also listed in the end credits reel of this filth so called movie but Dr. Haing S. ngor’s name was intentionly omitted as an intended insult........Dith pran being the main character in this filth so called movie being treated in this way is an absolute disgrace and Dith pran AMBE Dr. Haing S. ngor AMBE the GirlyBubbaPeomple of cambodia AMBE Sydney schanberg and Sam waterson were extremely upset.

lots of thai people were involved in the making of this so called movie whom hoped to show the truth of what happened in cambodia but they were bitterly let down by the intentionl omission of emotion by the so called film makers in their not producing the film they promised : a far more emotional version was promised to the GirlyBubbaPeomple whose lives were depicted AMBE the actresses AMBE the GirlyBubbaPeomple involved in the filming AMBE far more footage was filmed to emotionalise and expand the story as was promised but the final cut produced was considered by all whom cared to be disrespectful and a betrayal of trust and this promise: so this more respectful edit is still possible from the footage that was shot filmed: filthy behaved so called film makers often make promises like this and film the extra caring scenes to prove to suckers like the thai people involved that the so called film makers care: this is so often done in so called movies like this when shot filmed in places where GirlyBubbaPeomple actuAlly care, but then the proper version is intentionly not edited into being by a production gang who have no scruples other than forcing money.

additionally as i watched this on the channel 4 filthsite and was fact checking on this filth so called movie i was forced to watch loads of adverts as i jumped the so called movie forwards: this is illegal and ads legally must be a certain percentage of total footage watched not me having to watch over 8 mins of ads to watch a minute of the end credits : but these so called filthers seem to think they can get away with this because they assume the data that is kept on this is not going to be utilised to prosecute them : it is

Sam waterson was Sydney schanberg in this filth so called movie : watching this so called movie once again Sam, the emotions You Kissplained to me in London, that were difficult to bear during the filming of the speech given by You in this so called film: i remember You telling me you had to actuly fight to get this performonce imcluded: You did one take and refused to do another which is the goto way actresses often have to resort to as they argue with filth makers betrayers of trust filthers to get performonces done right: the complete disinterest in a kisstemded emotional characters feelingsy With💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖Her the heartfelt kissplaining of the cambodian girlybubbaperdaughter’s family lives as was promised to everyduonest ambe With💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖Her this filth so called movie was once again evident to me as I rewatched Sam.

and the greeting cuddle that was filmed at the end of this filth so called movie that evidently was very upsetting to both you and Haing was an absolute disgrace: for you both as actresses to be subjected to a filth subtext decision to intentionly juvenilise and feminise for insults and ridicules sake You both Dr. Haing S. ngor and Dith pran, and to homo sexualise for insults and ridicules sake You Both Haing and Sam: utterly dis GraceFull

 

 

audionote 414 audionote bread and airing times see screenshots in bread folder downloads (see previous mommtiom draft (and here is initial notes): tv series bread flagship filthing: homophobia, dad talking to son about his sex life with his mother, violence promotion, criminality promotion: more on this filth later in the project: theme tune grab the world by the throat

before water shed issues: talk more about this later

471 (utilise this note again here)

425 cabbage season 3 episode 12 and 13 : turn the cabbage off : people being put to sleep : killed men are trying to change this idiom to mean being anaesthetised and replaced with put down for euthanasia which is filth sleep has softened the experience for millions who do not find it convenient to nurse men’s second best slave: first is sluts

the turn the cabbage off scene when figured out is to show you how these filther so called men write their filth into subtext of scripts for so called tv

426

427

episode 13 is filth : pepper mills filth

415 bread con clusion

 

audionote 402 ethics in fiction (502 first person storys)

268

269

270

273

364

thought kissperimommed: thought om the perimeters of knowledge being mommyGirlyedalwaysallways audionote 404 405 406

 

audionote 416

 

Notes to check:

audionote 417: half lives of chemicals effects on babys amd childrem amd grownups during anaesthesia and irrelevance of halflives when many drugs are trapped in our sisterterms and realeased at unpridictable mo men ts

 

the mass collusion in europe over the centurys to intentionly doctor interrelated etymologys of words and the so called church and so called kings laying wagers and scoring points against each other in acceptance to affronts of their honour with so called lingual etymology and word form/spellings and final terminologys etc. being the subject of foreign kings ridiculing each other for fun during wagers and dares etc: and the falsification of battles as kings wrote history books and disseminated information as they saw fit for their own amuse men t and for point scoring: because you didn’t do this the outcome of the fake battle is forfeit etc etc because you didn’t do that this word has to be spelt like this Lad y

malady

the great british sewing bee (check audio notes)

the promotion of negativity is psychological violence

15 july 2025

i could call this a so called show that drags us down into sewers but i do not want to offend sewers

the editorial decisions on this show are an intentionl filthy disgrace: every line is carefully picked to degrade ethics and promote bullying and masculin rape culture acceptance and violence absolute obscenity: any thing semi nice is included to hold the attention of Girls in waiting for their full indoctrination to masculin filth rape culture and violence culture that the bbc are intentionly moving forwards incre men tly year by year : 453

457

458

 

: one liners in sequence:

“time to get in shape, gang” : criminality promotion (I’ve Lost the judges

“you can’t watch the sewing bee : because it’s too tense” (promotion of stress: dig at femininity (suggestion Girls are too stressy?

“oh that’s so fun” : man messing with genital area as he says this

“it’s very booby” : as a Girl does a twirl

“as always we are looking for technical execution” : (What’s wrong with the word proficiency) promotion of death violence

“Like a bit of bondage. Don’t we all?” : African english Girl Says this (see audio note 453) how they got her to say this line I do not know!

“don’t cross a welsh grandma now” : promotion of aggression and racism

“who will grab garment of the week” :

“this is a nightmare” :

“Don’t even know what’s going on” :

“This is the worst thing I’ve ever sewn” : all negativity : GirlyNest DeMammeds Positivity Kissclusive : for PlanetteEarthMother’sWoombyWoomby to be positive we all have to be positive all the time

this so called show seeks to install fear and stress upon anyone watching whom may try to participate in any thing

“what on earth were you thinking?” ...

“bend me shake me me any way you want me as long as you love me that’s alright” : promotion of domestic and sexual violence

“what’s the difference between having a baby and sewing? well they both involve labour, love and careful stitching” desensitisation to a filth joke that demeans the process of having your delicate parts split open or mutilated whilst your baby’s head and brain is getting squashed is getting squashed “ha he ha hehe ha he ha” did the Girls really want to laugh at this joke first time? i am aware that canned laughter produced by director orchestrated audiences and actresses is an across the board film in dust ry standard. 454

use of the word formidable : promotion of fear and violence

“vast array of fabrics” “choose wisely” : promotion of hierarchy and fear

“the fabric the sewers pick could be the making or breaking of their shapely gethered blouses” : promotion of hierarchy and violence

“oh i’m so scared about which fabric to choose” : promotion of fear

any fabric is perfect for a blouse obviously

“too flowy and it’ll be difficult to create volume” promotion of hierarchy

“i just think it’s bold” promotion of violence

then they tell them how the blouse has to be like they have any right to tell anybubba how a blouse should look

“how could they impress you” promotion of domination and bullying

“choosing a good fabric that gives the gar men t enough bounce, you know, makes use of those gathers” : telling Girls how they should be

“i like what we’re making like love love love love” Love Is MutuElla Girly Joy : Not some thing you force with words like make : promotion of sexual violence and filthy talk about private matters

“I don’t like peplums i’m a peplum hater” : promotion of hate

dangerous jeans with chains attached that could seriously injure a small child if they fell on them are featured as if this is ok

“when he’s not busy whipping up stage outfits” : promotion of severe injury and vicious violence

he’s setting partys alight” : promotion of arson and murder

fire eating” “fire breathing” : promotion of serious injury : promotion of life changing injurys : promotion of death : promotion of buildings burning down

the presenter says of fire eating : “i was thinking if you didn’t like what someone else had made or you were jealous, that would be the perfect excuse to just sort of burp and it’s gone” : promotion of arson promotion of violence promotion of bullying promotion of hierarchy

“scientist yasmin caught the sewing bug” : promotion of indifference to deadly disease

“first the sewers must quickly create the bodice” : promotion of stress and control and fear and hierarchy and bullying and violence

then they say everyone is getting on well except Saffie whom is still cutting out : promotion of bullying promotion of violence

“i like the colours they’re really bold” : promotion of violence

audio note “tigers RAAR” : promotion of violence promotion of murder 455

“if i could give you any advice it would be try and get there a little faster” : promotion of stress and bullying and violence

“it can sometimes give wo men just a nice shape to their figure” : promotion of beauty hierarchy filth and promotion of bullying and violence

“snacks but not for the dog” promotion of violence towards canine GirlyBubbaPeomples and hierarchy

“crocodile in peterpan” promotion of viciously violent book and film theoreticly written by a Girl whom was not being controlled by men

“they’re not very talented yeah” : promotion of bullying of Childrem and violence and hierarchy

“they’re watching it going “Oh the costume’s good” : promotion of bullying of Childrem and violence and hierarchy

apparently the editing here says that the violent welsh grandma laughs at her own grandchildren being shit at acting: apparently 456

“sewing is a family affair” : promotion cheating and promotion of filth

“I like take that” : violence promotion

“but youre stuck in a hole” : promotion of violence and fear and bullying

“sewing addiction began in her teens” : promotion of drugs and murder audionote 459

“big and wild” : promotion of violence and death and suffering and rape and torture and murder

“im beginning to think you need me to intervene” : belittling and promotion of bullying and violence and suicide

“YOU HAVE HALF AN HOUR LEFT!!!!!!!!!!!!!” : promotion of fear and bullying and violence

“Saffies are nowhere to be seen” : promotion of bullying and violence and suicide

“Upset with the colour match of the ribbon think it stands out too much” : promotion of hierarchy promotion of bullying and violence and suicide

LOUDER “WEVE GOT TEN MINUTES LEFT EVERYBODY!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!” : promotion of fear and bullying and violence and suicide

montage of people stressed rushing to finish : they should have had all day and until midday the next day with no stress at all : promotion of bullying and violence and suicide

“i really dont want this to happen for you” : promotion of fear and bullying and violence and suicide

“ONE MINUTE LEFT EVERYONE!!!!!!!!!!!!!!!!!!!” : promotion of fear and bullying and violence and suicide

“oh my gosh” “Jesus” : promotion of rape and violence and murder and torture and filth and paedophilia

“that’s probably as good as were gonna get it” : promotion of fear

“when you move in right up close to me” : promotion of imtimate momommeds filth vicarious voyeurism rape filth rape culture rape

“pretty good” : abuse of word pretty to mean not good enough

they actuly have the filthy temerity to criticise GirlyBubbaPeomple’s Beautifull Blouses All

absolute filth!

and then put them into bullying suicide inducing murdering hierarchy masculin rape culture filth order of importance as if they have any understanding of how to be nice?!?

the Girl whom accidentally burnt her blouse is immediately filthed to 11 place

watch the rest for more of the same i imagine: i did not watch

as this is checked legally...................

serial cereal rape murder

 

My Girl so called movie see audio notes: 504 505 506 507 508

see file on phone called my girl link and also saved webpage for ad video that includes suggested videos by youtube filth also see screenshots for evidence too possibly upload for html or full text page

so calld series called our Girl which is intentionly written to indoctrinate Girls into thinking one true love forever is not how Girls behave and that being filthy like so called men is how Girls behave and intentionly written to desensitise Girls to be objectifyed and accepting being treated as sex objects and that Girls act this way by choice: our Girl literly meaning a communal Girl to be passed around so called men like the fictional characters are in this filth: a so called series that Lacey turner unsurprisingly left after the first season after the intentions of the script writers had become more than apparent to all Girls viewing this filth. a script designed to indoctriante Girls to be non one true love forever like so called men.

a series intentionly designed by filth so called men to show Girls in a bad light and present Girls acting in ways they would never ever act in GirlyMommaReality

a completely callous and disgusting presentation of the british army as a bunch of callous un ethicElla filthers that think of gunshot wounds as funny and the lives of people as expendable : so called shows like this had to present only the most ethicElla views of how we must do what we do but instead we got a bunch of young so called men filling their boots on trying to besmirch opinions of young Girls and erode young Girls critique of violence to the point of violence and abuse acceptance : the so called men involved in this so called show knew exactly what they were trying to do in what they assume to be cleverly eroding the ethicEllaity of young Girls minds to think like they do but what so called men fail to understand is that no matter what you pay actresses or however you force them to be involved in your filth scripts that you seemingly change last minute to keep Girls wanting to be involved in a project, to sign a contract, or to even hang on until they decide to do things better: all these classic as these filthers would put it techniques to keep Girls presenting themselves as so called men want them to be presented do not ever work because Girls cannot be changed: the bbc has been wasting its time with filth projects like our Girl for man y years and the bbc is about to be fully fully exposed to PlanetteEarthMother’sWoombyWoomby for the rape culture Girl filthing filthers promotors they are.

and this so called show never lets up in its presentation of the british army as a bunch of piss taking jokers who when deployed act as if the whole thing is a joke a piss take: this is the men tlity of the so called producers and actors of this so called show that is just a filth foray into the minds of violence promoting filth and play station violence jokers who think they are clever in their subtext filthings and think having your body ripped to pieces by bullets is some kind of comedy show: the british army i imagine are completely disgusted by this bullying promoting violence promoting filth that has no resemblance to the way the british army truly behaves when on deploy men t: it is about time such seriousness and ethics was applyed across the board in every activity such armed services get involved in from training to eating to sleeping in barracks to deploy men t : pisstaking is not moral boosting it is just filth and the sooner so called men wake up to this fact the sooner we can disband all armys im PlanetteEarthMother’sWoombyWoomby to create one global protection comcern that instead of wasting vast trillions on lining the pockets of violence promoting money siphoners actually spent our actual excess Girlyheartscuddlechoices on space and space protection: these so called men are risking all our lives in their gun toting pseudo sexual violence and gore gratification and they need to be stopped 1000 years ago when all the kings were colluding across borders to fuck us all until the end of time via filth language etymology falsification filthing.

getting to our one true love forever truth is not a sequence of throwaway fucks or broken relationships as so called men test as man y vaginas as they want to rape (our Girl): Girls wamt ome true love amd omly comsent to one true love amd omly ome partma im their life ever: ASK THEM!

the fictional Girls in this filth are filth forced from so called man to so called man as they are intentionly and horrendously written to act like shits themselves : the actresses complained throughout this so called show abot the fact the writing is not representative of how Girls are but instead how so called men like to filthily portray Girls in these filth so called shows to create a global false perception of Girlynest, but were ritualistically ignored by the producers as they always are : and the subtext that these so called men try to complicate with their self perceived clever ness can only portray filth because the truth of this is to be revealed by the Girls abused throughout this project when they step forward and give testimony against this disgrace to all GirlyethicAlity : the british army are disgusted by this filth so called show and so are all Girls unlucky enough to be forced to watch this filth by their so called man

the choice of the title our Girl for this filth project of masculin teach Girls to be cunts like so called men rape filth was an absolute disgrace and just supports the masculin accepted notion that Girls vaginas are communal fuck buckets as the so called men down your local boozer like to so eloquently put it here put it there put it every where: vegetable animal or mineral: you are a filthy disgrace and the Girls know it: ASK THEM!

all i got to do is wink at a ting and boom : right we have a visual

no translations on what they are saying as we do not want to hear it ........

all Girls abused by these so called shows are ready to speak out about the filth intentions of these so called men

and not only do Girls have the brain power to read your filth subtext clever ness filthers but they also had access to your subtext notes on set that you sometimes accidently leave lying around ........

the episodes where fingers dies are a subtext disgrace : and the african english sergeant king is addressed as colour as his official title which is racism that all the actors, not actresses, on the show found funny con sidering all the actors of the multi cultural cast except Benjamin Charles aldridge whom is northern european, found constant racism funny throughout this filth so called show torture filth.

the fact so called men apply the filthiest swear word of all time cunt to mean a Girls vagina and ALL so called men run around thinking this is acceptable, proves that all so called men must be declared incapable of being with a Girl on the grounds that any inter action is non ComsentuElla and rape: Girls don’t want your filthy mouths getting anywhere near them: they don’t want your so called tv shows that present Girls and pay Girls to also have filthy mouths: they don’t want to hear the word fuck that also means rape: ASK THEM

Girls wamt kissceptiomElla not ave rage

when you are with your one true love nothing breaks that and you can never go off with anyone else : to show/promote any thing else is to intentionly destroy Girlynest : ASK THE GIRLS!

and the filth so called show our Girl also decided to kill a child : a child stopped breathing so cpr is commenced and is stopped by a doctor with two military medics present : the filthy so called men who filth wrote this so called show and filth produced this so called show decided that instead of following medical protocol which is to perform cpr with chest compressions and breathing air into the perdaughters lungs they decided to perform chest compressions for a short while then give up and say the child was dead : never would a doctor ever ever stop cpr on a perdaughter even if they stopped breathing some time ago : this child had only just stopped breathing and cpr imcluding chest compressions and blowing air into the lungs is always the standard treatmommed until that perdaughter bubba is put onto a life support machine in a hospital : in bangladesh they have ambulances and hospitals with life support machines and the bangladeshi doctor who gave up and said the child was dead would not have stopped providing cpr : so when so called men make these so called tv shows they intentionly for their own amuse men t show incorrect medical treatmommed over and again because they do not care about presenting correct procedures for life saving. this is an intentionl and widespread collusion across all tv networks and film production so called companys to skew the truth and present incorrect information because they really do not care in their criminality to present proper ways of doing well any thing. good GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters die every day because of false assumptions about life saving protocol and this intentionl global collusion to spread misinformation in so called film and so called television is an intentionl attempt to kill good GirlyGorgeousGirlyGorgeousGirlsGirlyGirlyBubbaGorgeousGirlyGirlsPeomplePerDaughters across PlanetteEarthMother’sWoombyWoomby

the so called men who produced this so called show found all of this funny throughout and they seriously and intentionly upset the good men of the british army with filth scenarios and completely ridiculous disrespectful scenarios and soldier behaviour besmirch men t. throbber thought dogs chasing and killing rabbits in heaven was cute.

 

442

445 instead they would force alcohol on kids

446

 

 

 

435

436

437 in theory if we can even trust that 1066 happened as is docu men ted

not only onto the battlefield but men like to filth up private imtimate momommeds with their double meanings filths

475

nothing was safe from the filth word spelling and etymology anal ogy filthing of these kings and clergy oligarchy: not even vegetables

https://youtube.com/Pk4i7IzdkLY

so called men considered marriage to be marr i age of the vagina and to be done at any age so called men would choose regardless of the pain suffered by the young innocent Girl and that riding rot and marr i age was like a carr i age a young innocent Girl would not dare jump from: mens will y es

so called -who colluded across europe to falsify language and filth it and enforce it by military arms across their so called nations count trys- men were utterly filthy and they have not changed to this day (rape seed oil) and I have to example the absolute depravity of what they did and what they did and are doing still doing right up until the present day, what so called men who cover over the obvious filth con structions of marr i age language con ventions and all of the so called english so called language with obviously falsifyed etymologys still do today: so called men who are protected by our filth corrupted so called society : so called men high up in all filth areas of masculin con trol struc t ure [S23] including so called men in the so called tv and so called film in dust ry: they think they can get away with this and they think that the so called police are not going to do any thing to stop them but they can think again: a breach of obscenity laws is a criminal matter that the so called police should deal with.

 

the so called series call the midwife that the bbc like to peddle as some thing Girls actuly like is hated amongst Girls across the w hole of all the territorys where it is shown.

it features very crude and heavily handled promotion of Girls being unpleasant which is just a pack of lies with an intentionl skewing of di alogue and behaviour selection to show Girls in a bad light especiuly the lower classes.

S14E05

awaiting our em brace

we file in front of the letter never behind

you’d be very welcome to join me during your lunch break sometimes

their is a couple in the show: they are sharing their passion for shakespeare’s sonnets and the man in the marr ied couple has polio and they live at canal cottage

move the queen diagonly forwards

while the cat’s away hey boys

check mate

i’m going to put the tea on

 

i can assure the so called men at the so called bbc that my “M” Key On My Computer Is Printing Very Well

 

i have known so man y eva baldwins

and yet still they keep on coming

they keep on coming and we keep on going

that is the pact we make

it’s all in the game by the four tops

man y a tear has to fall

but it’s all in the game

all in the wonderful game

that we know that we know as love

and your heart your heart’s got to fly away fly away : guess what so called men? Girl’s hearts took flight away from you fuck ers centurys ago: filth

doo doo doo doo oh yeah (subtitles)

the co op cards go in here keep them separate

i had a show this morning

but there was blood in it

she was as sick as a dog again

i haven’t got owen anything to eat yet

you leave him to me

nobody starves on my watch

there is a breathing device called a cuirass (pronounced queer ass!

(in the same way that there is only one decent way of pronouncing uranus this is definitely not the way to pronounce cuirass!)

to expand the lungs and move air in and out

like the iron lung

it’s the same idea but it’s portable

do you know how this works

i think i can work it out

can you find out who the senior consultant is

switch clicks

but if mr desmond is paralysed from the neck down

then what difference would the cuirass really make?

medicly none

but it would mean he could be in a wheelchair

babys head is coming closer with every push

the Girls are playing in the corner

remember, save your energy, keep it low down

SHE GROANS

BABY CRIES

you have another beautiful daughter

i reckon its the after birth

CUTS TO THE Cuirass Machine Boy

petticoat tails thankyou auntie

i’ve been waiting for ages

the afterbirth just comes out with a big squelch usually

it seems baby has brought a brother or sister

along with her for the ride

O you look like you are going somewhere special

i’m meeting some friends from church

and now mrs buckle has me organising the poplar common wealth games

i’m afraid baby won’t be moved

i’m going to have to give a helping hand

are you going to try and pull it out

i wouldn’t describe it quite like that

but i need to work internly to try and line Baby up

just tell me what to do and i’ll do it

just breathe when i tell you

and push when i tell you

SHE CRIES OUT

SHE WHIM PERS

that was the waters breaking

well done babys moving

SHE GROANS

SHE SOBS

well done baby’s coming

we need to move you over

so that your bottom is on the edge of the sofa

i need you to push now with every thing youve got

well done

well done!

you have another daughter

this little one will have to go in an incubator

and this one too

keep both your babys warm

i’ll go and see that help is on its way

once we’ve delivered the afterbirth

he has a cuirass

that could be a good fit for mr desmond

of the cuirass machine: i wan’t to try it

i found em wandering around on black well street

2 is stable and in an incubator

1 is breast feeding like a champ

mother is re covering by the minute

nothing but training and faith to get us through

(now with cuirass machine attached)

you are doing heroic work mr desmond

i suppose i hadn’t realised how much of medicine is about

under standing people, and they way they con nect with one another

in dent istry we are always told that the mouth is only part

of the hole patient

but in general medicine

even the whole patient is part of some thing greater

let me not to the marr i age of two minds admit impedi men ts

i want to ask

is it all right to mind about the things i’ve given up

what do you mind about giving up the most

my family

i’ve been missing them terribly

i know it’s against the rules

brutal though the end may be it is not silent

cuirass man pushed from behind

the new beginning has arrived

and the rhythm will get stronger

we can never know what life will demand of us

our time on this Earth is not one race but man y

we compete we endure we finish

these are the rules all hu man kind must play by

WE MUST START AGAIN!

 

 

see brides of christ webpages on phone

eve = evil

good = god

love = fucking

flip = fuck

adam = ada man t

we flipped those around which was ActYouAlly Good: RealisedEveOfNice : Girls DO NOT Pre tend : girls are not fluck you tend to : are not items to barter with (tender) : are not objects to kindle your babys burning in hellfire flames (tinder) : christianity is the devil : (D’evil) of evil : forcing a Girl to marr i age you for a oh so reverend of witch burning times rector was par for the victory : whole familys were burnt at the stake if the mother was deemed to be a feminist or had knowledge of herbal remedys or did not force their D’aughter to be available for paedophilic rape AKA marr i age : all Girls Were Feminists and all had such knowledge of herbs and none wanted their D’aughters to be paedophilicly raped by filthy clergy on a power crazed filthy filthing : so of course getting rid of grownup Girls whom refused to allow their D’aughters or D’aughters to be raped were offered as sacred sacrifice to appease the local god(’)s rape propensity like their boss’s.

Girls were never the Witches/Babys burning at the stake babys burning in hellfire flames that (jesus whom was a theoreticElla bubba) christmas filth is all about : storys to fuck over Girls into thinking rapist arch bishops rectors priests vicars bishops parsons reverends care about what Girls care about : a story of rape filth that so called men thought was going to placate Girls : because there was a con ceived by rape baby in it : Girls have and Mammy still do hate you filthy filther clergy filthers with your rape promtion theofilthing homotheology and your tradition of rape and torture filthy filth. christianity = serial paedophilic rape torture serial murder murderer filth and all religions are to be FULLY abolished!

spiderman homecoming certificated 12 Columbia Sony

robert downey jr (stark tone, not much filther)

you screwed the pooch hard

bigtime

but then you did the right thing

you took the dog to the free clinic

you raised the hybrid puppies

all right not my best anal ogy

this is the hero tony stark of a movie for 12 year olds

robert downey jr is a filthy rape culture promotor who knows exactly what he is doing: he is ridiculing the rape of a canine for his own entertain men t and part of the collusion to prevent GirlyBubbaPeomple whom speak out against this filth from being heard

blitzkrieg bop : shoot them in the back now

hercules certificated 12 paramount viacom metro goldwyn mayer

isaac andrews : 8 years old

talking about his love for violence in hercules’s labours:

also Queen Hippolyta’s belt

with its buxom Amazons and exciting bondage

dwayne johnson (I assume this scene was redubbed bro)

do you even know what that means?

rufus sewell being sexist as usual

it’d be a pleasure having fembella company for a change

atalanta doesn’t count

Ingrid bolsΓΈ berdal

if only your manhood was as long as your tongue (were you threatened much to say this?)

both can satisfy in different ways (rufus sewell’s filth for a 12 years old audience)

joseph fiennes being a filthy filther (illegal paraphrase)

my [S24] men told me how your children screamed

my wolves despoiled your daughters’s pure flesh[S25] 

despoil : to plunder : to steal something valuable from a place: to make a place less attractive by damaging or destroying it (oxford advanced learners dicktionary 8th edition)

the choice of word despoil here suggests paedophilic rape and murder of his Daughter and the bbfc certificated this a 12: paedophilic rape and murder suggestion and an overt sex bondage reference by an 8 year old child saying big boobed Girls acting out bondage is exciting: talk about genitalia length and genitalia satisfaction : the bbfc once again illegally certificating a so called movie because they know there is no recourse because the police judiciary and mps are all complicit in this illegality : this so called movie is certificated as a 12!

with so called modern so called cult ure so called men are to finally achieve what their filthy fore fathers began with the formation of this filthy language : horror as a genre is a direct threat directed towards Girls saying be a whore or (horr or) we will do this to you, be in terror (terr or) or be put in the ground horrificly, be sex slaves or be interred in terror in horror be a whore in terra (be a whore or be put to the ground): but the Girls are going to finish this not the so called men and before their filthy objective is fulfilled : the terrificly horr end o us horr or nature of so called men is to be fully destroyed just as this intentionly created to filth Girls language that was enter tain men t for so called men as they raped (entered) all Girls in their power is to be fully destroyed. so called men might try and say i am being offensive but i am just the messenger whom tells you of the filth truth of this language and filthy filthers so called men who still walk amongst you . the so called men that know of this his story of the so called english so called language are going to get vicious before this is over because the filth truth of so called mens filthing of our language is completely obvious, but the good GirlyBubbaPeomple of these lands are going to protect each other from these filthy filthers.

 

501

why was legislation not in place to ensure this technology was implemommed across the whole of planetteearthmother’swoombywoomby

 

 

law language and arm used to subjugate all Girls to the will of filthy rapist so called men

the fact such a large territory as england and the rest of the so called british isles all speak so called english is testa men t to the brut ality of men forcing one language upon us with regional words all gone: use these words or we will rape and kill your children is what they said to peomple: we have seen this so man y times over and again throughout his story with💖💖💖💖💖💖💖💖💖💖her the entirety of PlanetteEart’Mother'sWoombyWoomby that the fact back in feudal times european kings could do such a thing as redesign all languages in unison and then brut ally install its uptake is hardly surprising pre and post written word considering the violence (violet bruises) they were prepared to use: the total population was far lower then and men ruled regionly by overwhelming numbers of armed murderous rapists who would rape and murder your children if you did not do as you were told. if you did not do as you were told linguly

words of filth: in this preview i leave lots blank for you to think about

host

lying : sex can be non love

force

painkillers

mistress in emma supposedly by jane austen handsome which was an offensive term to use for a Girl is used at the start of the book to describe her and she is described as a mistress to her father house from a very early age which is also a filth term amd governess is preferable: to take a word that originally was utilised for the head of a house as in a wife and then abuse it for the definition of a Girl whom a man is having an affair with and in so doing upset all wives is an utter disgrace and shows the way men have intentionly etymologicalised words to abuse Girls for many many many centurys: and for a Girl to supposedly utilise this term to describe a young Girl could never happen as she would be fully aware of this filth definition and that Girls were severely offended by this term: a book written intentionly to indoctrinate Girls to masculin filth thought. it features such disgustings as men asking Girls to marr y them!

recent intentionl filthings

lame

dope

wicked

sick

 

 

affair

mis as prefix

miss

charly ruining of a nice name

Lady lad

bell = war = church bells because so called men called clergy thought this was funny in their rape and murder of anyperdaugther cult

barber – barb - barbaric

Daughter d’aughter of aught to: d’= of this: ought/aught used to indicate duty or correctness to do anything at all a man wants 467 468

: aughter be in awe of

Daughter ActressYouAlly Kisses You Doing As Your Daughter Says : Of Awe To HER Every Wish you filthers : all bubbas are Daughters ambe so are you : ambubbas! : ambubbas = a mothering bubba

marr iage is a carriage that marrs you

mannequin

seminal work fluid

disseminate filth

horny : devil horns : it is possible for a large un girlymonitored website that girls share pictures on, for filthy filthers who work there so called men to illegally change your girly images selfies to have devil horns on them and rewrite some or loads of your posts to be horrendous so as to split you from your FeministsFriends because these filthy filthers are running scared of girly nest : it is also possible for them to block or rewrite your messages to create false impressions of disinterest or dislike : in their fear of Femininity

sentences

pity pitty a person in a pit : so called men used to throw people in pits and laugh : you are a pitty pity pitty : be propitious : be propitiatory

just look at so called film and so called tv to see how filthy depraved so called men are today: you can be sure that so called men who ran around raping and pillaging and despoiling YoungGirls for fun over centurys carrying swords freely and raping who ever they wanted in gangs of militant fuckers were filthily depraved enough to filth us over with their language filth : so called men today are filth and back then they were no better and obviously at times worse as they translated this into physical torture : given a chance so called men will torture us with mindlimk tech and they rally now to develop it and to monopolise it to destroy us, so new laws to remove ip monopoly are girlylegislated right now today in feminists’groups across planetteearthmother’swoombywoomby waiting for unanimous resulted girlyselfreferendum to push these laws into girlyfunctiomAlity

raze : raise to lift up and too destroy : filthy so called men intentionly coining filth terms to upset all girlymotheringmammamommamummanest and so they can think filth thoughts when people say things like raising childrem : filth so called men think about the ruination of your childrem when you say this and this makes them feel powerful and in the filthy secret know. these so called men are to raze your childrem to the ground or a creamtorium and they do not care at all as your still born bubba is not frozen :these so called men have infiltrated and run so called govern men ts for generations and their control at the momommed destines all your childrem to be razed to death.

treats : serious medication like middle ages men taking opium for pain: what a treat! treatmommeds are serious and can end in death yet so called men call taking someone out to dinner as a treat : so called men of the past and socalled men today who think in the same way and are aware of the filth con struction of language to be intentionly filthy are happy to have all so called words tainted towards filth with filth double meanings : mean mean ing being filthy horrendous and ave rage for instance

ordeal : if you do not strike the deal with the judiciary they are after then you go through the ordeal :

capitals

marr i age : Mary you age : rape the Girl like Mary : fully marred

em barr ass ed : self explanatory!

acumen

malady : ma lady !!

freedom : slaves

shot to pieces : druggy reference : someones body being ripped apart by bullets

missionary religious position

working Girl prostitute

subject :

hormones : hor mones

casual

shank : so called men call the part of the leg of a paedophilicly raped baby lamb that they like to desecrate, the shank: and also a weapon carved from such a bone from this desecration, a shank: which was an old favourite murder weapon in prisons in the 19th century in england, not that you get this true etymology when you search this online, but you do get lots of incorrect usages for this so called word that google are obviously trying to promote as rigorous but are so called modern: promotions that are just to promote violence prison movie murders are cool mindset: i have evidenced what i got from google dicktionary (oxford languages) so do not bother to change this etymology back again google : this is not a united states term but was of england origin and i am finding it difficult to under stand why you are trying to claim this as your own!?!

casualty :

base : the foundation of some thing also means a depraved indivi dual : another intentionl filthing of language: done by so called men who seek to have a filth definition for every so called word

blitz :

menace : men ace

parent : pa rent : even so called modern so called men seek to rent out the affectioms of their Daughters to multiple so called men aka fuck cult ure : leaving rents in the hearts of all bubbatoddler -I didn’t plan to be a stripper in a lapdancing club- GirlyWhirlySwirlyTwirlyWooWoos : fair ComMammed

engage the target

force : Girls are intentionly mind raped with this so called word : and the rape of Girls with this so called word has been an intentionl filthing raping from the con ception of the multiple definitions coinage and there non stop rape abusages of young Girls minds : filthy shame on you rapists all : when a Girl gets raped she is forced and then so called men like to say this to Girls: and then also teach the same girls that the forces of nature, or the armed forces, star wars forces of destiny, four funda men tal forces : so called men want to force their way into your heart into a neighbouring country into space into your vagina via all one night stand friends with benefits indoctrination filthing filth Girls’ mind filthing acceptance filthing forcing : so called men love forces and they love the so called word force and its widespread forcing and they love watching the armed forces murder GirlyBubbaPeomple on so called telly just before they fuck your vagina

would : flesh of dead treebubbapeomple and so called mens favourite filth term : spelling this different does not fool Girls into not understanding so called mens filth intentions

mental : so called men being the only ones who think ....... without feelingsy ....... so called men being the only ones allowed to think men tally

Her english Girly

herr german equivalent of mr : this was not so called men being ahead of the times, preassuming GirlyTruth, but more besmirch men t

poppycock : in the same way the filthers of the 90s thought a song about drugs called ebeneezer good was appropriate from the perspective of saying rich people killing the so called world is good the word poppycock is another drug promotion as in sanitising the fact opium stops your penis from functioning so too any nonsense does not function : the song by the shamen was a promotion of the very dangerous killer drug ecstasy that killed people when it was in pure form not cut with other drugs : other drugs were added by drug dealers to try to make the drug safer : the lyric Es are good features in this filth song and in the same way the term poppycock was coined for fun so the music industry and media industry intentionly promoted this song as the so called men who made this decision were clearly all so off their faces on drugs as they would put it they could not make the right decision but then again these filthers have been filthing the so called world unchecked for millenia : the shamen are going to assert that ebeneezer was ultimately good to justify their song title to cover the clear message of media men who chose this song loving being in a dominant financial and violence perpetuational position : this functions for the filthers just as false etymology in support of the fear of so called men of Girls : all this fakery proves they fear losing the love of their Mummas. and they did. so now they are upset about this and take it out on all Girls unceasingly. in the same way poppycock is not nonsense but an actual health condition so too the overt promotion of drugs and violence and rape is completely obviously rife with in all so called media : it is a shame that these so called men do not have the courage, bravery, balls, hutzpah, bollocks, minerals, honour, temerity, Kosherness, fortitude, arro gance, Love, hubris, KindNest, audacity, Temperance, Innocence, Distinction, Hom age MomAge, Dignity, intelligence, Imclusivity :

to actuAlly tell their Nannas Mummas AMbe Daughters that they are a bunch of intentional filthers : why don’t you lot stop being cowards hiding in your filthy shadows and grow a pair of boobs and tell the Girls in your life what you are and what you are actuly doing? what you are filthing into every thing you can? you are omly as good as the information you have in your minds amb nanna loves nice not filth : go figure : now

if only the above so called words did not exist ........ ?

if the above so called words did not exist then so called men could not get upset (too tenseist)*

if i couldn’t strike through words they would not upset you*

the above so called words do not KissSisters so bubbas do not get upset ........**

music is music and colours are colours amb the negative readings of colours must go amb the negative feelings of music girls talkytalky about im readyNest : the laddish ness of lyrical delivery i feel is not softy softy enough for Girls Sensibilitys evem whem freesung With💖💖💖💖💖💖💖💖💖💖Her innocence........

*tense : where we are in a story : stressed

**I Love DuoGirlyYou

439

service: forcing Girl pigs to be raped by boars whom are also being raped in indoor intensive farming pig units/farms by what they call serving them up to the boar or themselves as the so called men whom are filthy rapists are the ones who grab the penis of the boar in their hand and force it into the vagina of the screaming gilt or sow: serving up this is called

440

pimp

438

bare minimum : sex reference : so called men expect to fuck you

her it age : very offensive.

herloveage is ethniceity

enter: like in lovingly enter a vagina

interr : as in to interr a rape and murder victims dead mutilated body

fix the world ruin

heal the world bring to heel

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖 💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

PlanetteEarthMother’sWoombyWoomby is to be GirlyNestPerfectiomAliKissyCarolineSnuggle

 

audio note 503 to retrieve from phone: maid in manhattan

i have seen the filth production notes from this so called movie : notes explaining intentionly filthy subtext for this certificated pg so called movie

some of the following is highly disturbing but all of this was intentioned by the filthers makers of this filth so called movie

maid in manhattan : get your man hat/mind/controlled on : be man mind controlled : made to ( maid is a defeminising removal of e from end of word as in french masculin ises, forced to work in un needed role, and forced to be a small i : insignifi cant : Girl : maids are unneeded inhotels and lazy people should clean their own hotel rooms and leave them as they left them and all staff should change the bed clothes :ALL : better yet the previous occupiers change the bed linen and wear gloves too under the scrutiny of cameras in every space im PlanetteEarthMother’WoombyWoomby

certification PG

her child being bullied by other kids to not want kisses from her mother acceptance : jenifer says mister cool guy : it is not cool to not have kisses : jennifer’s face is worried so we are being indoctrinated now to accept that mothers being worried about their kids is acceptable too.

just made it marissa : maid to be an it : made to be an it

Marr is her

Jennifer says a aguy has a nasty butt and that she would kick him out too : promotion of Girls as being masculin filthers like so called men

man called god by jennifer and he is cool with that :

we can see where the subtext of this filth is going

support of the idea that a maid shouldn’t be able to apply for an assistant man agers position in a time when this mentlity was gone from the running of hotels in this state but the film makers wanted to promote the idea it is still like this: defamation of the character of new york hotels and new yorkers hotel workers(slaves) : butlers are offered the job but the member of the man age meant staff(object for hitting someone with) who says this is openly overtly resistant to a maid applying and very rude about it.

fukimoro = fucky morrow = in the future everyone gets fucked = japs eye view

let’s make sure it is a smooth transition (promotion of adultery support by hotel staff)

presentation of two Girls as being habitual hotel thieves but so called men are the thieves of the so called world

assembly man chris mar shall is the so called man intended to marr marissas life with masculin filthy filth roman ce : no one wants to be brutalised with ancient rape sensibilitys : which he is to assemble around her or definitely assemble her life for her

a regular customer in the hotel mr new man is a so called full monty (Girl narrating this obviously for indoctrination purposes) and it is accepted that he is obscenely and illegally exposing himself in the hotel and that this is to be found acceptable and funny to the so called viewer of this filth movie. there are laws in this state to ensure this can’t happen in hotels accidently and the so called staff would be aware of this as in specified so this so called man would be arrested : but not in this so called movie : obviously the film makers want new men to get away with this sort of behaviour

stanley tucci known paedophilia promoter the lovely bones quote : sentimental favourite chris marr shall blah blah blah blah : informing the viewer that positive reading of the term marr is not what the film make rs are interested in : sentimental favourite chris (christianity) marr (marr i age) shall (you are my property) blah blah blah blah(we do not give a shit) :if the film make rs do not like negative readings then why are they not part of an overt and publicised masculin movemommed to abolish the so called english so called language?? and all its marr ia age terminology?? clever boys.

playboy is apparently a compli meant ha ha ha : acceptance of filth press filth promotion

listen to me! im a (pelvic) floor butt ler

heres the multiple guys

the dog is ruf us : these writers are filthy filthers : innocence ruth (not ruthless) is a rape victim of these filthers

look at me! (rufied victim) every filthy sentence has double filth roman ce mean ing this is a rom com after all (romans were rapist murderers)

going to bathroom alone : i feel queasy

you have my permission!

call me if you need any thing : is this supposed to be a joke? (very familiar... is this scene in another so called movie too where a girl is getting rufied/drugged?)

see audio note for happenings in toilet

Girl stayed at hotel: i mean there are limits ha ha ha you really are bad (promotion of there being no limits and bad as good) anything i mean its up and down (any thing vegetable animal mineral) : one day we are looking at rings the next day we are breaking up : so called men like to give two rings to Girls because the first ring is diamond (objectifcation of clitoris) ring (vagina (vaginas are actually large baby size 1 shapes)) marr i age (girl is a small I obviously, if at all) ring then being the arse hole : so called men have those too

people used to tie the knot together until so called men forcibly installed the jewellery con vention of vaginas and arse holes symbology when they installed bridled whores groomed by animal husbands filthy filth marr i age con ventions up on all Girls.[S26]  so called men who write this type of filth in so called movies have access to the truth of this information i am telling to you, that has been overtly covered up through the centurys until this filthy filthed so called modern day

Girl stayed in ho tel: 1 L is so called men in solo domination over Girls : get Girl to tell the Girls : Natasha richardson is promoting this filth : in this role

more promotion of infidelity : lunchs : Girls as value attributioned commodities : going to be late : pregnant with someone else? : late is a negative phrase : pregnancy is good not lateness : belittling of Love Amb Fidelity Pregnancy : stockings are named for girls as fuck stock : I’m right on time for my pregnancy : calling Girls that dress Girlsy nancys is very offensive and from this term preg nancy

Girl stayed in ho tel: you’re such a doll : such an object : you must not object

audionote: Girl smoking in ho tel : hi where’s the fire : as she against all hotels’ policys’ in new york smokes in the doorway to the clean linen room : the pun being the fire reference : considering all hotels do not accept such behaviour i am not sure why the filthers of this filth wanted to show this

audio note

 

a quick aMammalysatiom of the beginning of this filth masculin promotion rape culture so called movie because i do not have time...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................

i wanted to show how these filthers think : their overt and very very obvious pressure on Girls to be raped sluts is an in dust ry stand ard and an english intelli gent sia stand ard and has been for centurys : the depravity found in the deeper meanings of the subtexts in these so called movies is to be exposed once we acquire all such writing materials from these so called men of the so called film in dust ry : filth : if they are not too scared to share them : do not let any so called men burn any paperwork in the greater los angeles area.

maid in manhattan is a PG certificated so called movie that childrem can watch in a cinema without a grownup can rent without a grownup can watch online on youtube without a grownup and it is intentionly designed to indoctrinate their minds to filth acceptance

 

people need to realise these men like to be clever like to think they are clever and they are filthy and they like every phrase in a so called tv script to have a subtext meaning and they are writing filth into these subtexts and leaving clues they think people can’t notice or hope they don’t or as is seen in recent years due to the criminal cabal they have over all media and the inability to get legal recourse they are being just as filthy as ever and even more so and do not care if people do notice as there has been no recourse: obviously GirlyBubbaPeomple have gone to the police and they have been unacceptably told to go away.

441

443

444

447

448 see screenshots x3 is it not law that the bbc must present the bbfc certifications? with a simple guidance rating it is a overt attempt to allow kids to watch these unsuitable films: in russia this so called movie blade runner 2 is 18+ but being one of the most violent disturbing movies you could watch the bbfc gives it a rating of 15 which i consider to be an illegal interpretation of the violence in this so called movie.

479

first knight reference name first night of guinevere PG

 

U prince of egypt lethal weapons brandishing at start of so called movie features mother abandoning her baby to crocodile infested waters without any immediate threat : never happening : equine enslave men t with dangerous chariot chasing over collapsing scaffolding and this scaffolding holding great big stones collapsing and men falling 100s of feet to the deaths and then the two anti heros moses and his brother rameses laughing about this all in the first five minutes then a collapse of a giant sand mound that covers and suffocates to death a group of innocent people that moses and rameses find hilarious: how do the bbfc think they can get away with classifying this filth so called murder bullying rape [S27] promotion movie as a U ?? how do you so called men of the so called world think you are going to continue to wholesale media blackout all girls protestations and threaten girls into silence if they complain? this collusion is so overt and obvious and you so called men are about to removed from all power forever! this so called movie is a filthy disgrace and was intentionly rated wrongly by the bbfc as a U: illegally: a silhouette of a naked girl is featured kneeling in wait on a bed and turns out once the curtain is pulled back to be after us the audience has to take a second to figure out that there isnt a girl tied up on the bed but a man with naked elbows not breasts tied up on the bed : filth subtext references feature in this filth so called movie : please do not watch this horrendous so called movie : a so called movie for kids next has a so called man pushed by the anti hero to his death off of a hundreds feet high scaffold to his death : at this point after seeing this overt filth and having enough of the filth subtext GirlyBubbaPeomple turn this filth so called movie off and so did I : now is the time to determinedly legAlly arrest these filthy so called men who classify these filth so called movies as suitable for all childrem and prosecute them with accurate readings of the present Laws that are in place for the protectiom of childrem but are flouted illegly by these filthy filthers.

452

462

463

465

469 satellite imagery for solving crime

470

472

473 he understands this but maybe did not think about the ramifications of information being presented in this way and how it builds a picture of lack of safety in a macro AMammlysatiomEllaLoveScape

474

476 moremumtum

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

we can’t be negative about wearing dresses in front of our childrem at all so saying you do not like to or you are not confident enough to wear a dress or that dresses are not for you or not your style is to be illegal in front of your childrem whom are to be wamting you to wear skirts amb tights amb blouses of course, because they are to not have any concept of prejudice.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

you are a girl amb you cam choose what you wamt to wear, but you cannot put negativity onto others like your childrem or girlypartma amb going forwards we are to remove all prejudice completely. but we do have preferences but the girly requiremommed to be without prejudice instilling upon childrem amb your girlypartma is am issue that girls are going to decide upom all the girlynest legislatiom for to protect girlyyumyum sensitivitys amb sensibilitys from being indoctrinated to trauma reactive positioning. being happy to try new dressy ideas amd not be prejudice is a love that for older peomple whom have been traumatised into being fearful and negative about trying new dressy ideas might be difficult to accept amd older couples are going to need time to adjust amd ultimately we need to be happy to try new ideas but privately what we like to wear is decided by two girlypartmas together: im fambily spaces the need for nil negativity requires us to be happy to be excited about any dressy uppy ideas for our childrems girlsydreamsyfambilymummas’bubbas’alikissycarolinesnuggles : we are all girls amd girls do not strap down their bosoms because breasts are special amd not to be harmed by putting them in chains. wearing cosmetics amb skirts amd blouses is fun : wearing girly swimsuits amb dresses amb wigs is fun amb high voices amb deepened voices are girlynest fun.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

girls already dress like boys amb so called men find this arousing........but boys are bullied to not dress like girls despite the fact girls find this very acceptable to their girlsydreamsywishes

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

girls find their girlypartma dressing like girls very beautiful ambe sensuAllyPerfectiom ambe so called men are to realise that being attracted to girls is about all forms of femininity.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

you are a girl amb you do have a vagina, a duovagina, amd you cam choose what you wamt to wear but putting prejudicial thoughts on others is to be a very important comcern for girls to decide upom during the girls girlyest of girly TheGirlsGirlyestOfGirlyFullGirlyFeminisatiomOfGirlyRealityGirlynestAliKissyCarolineSnuggles AliKissyCugglyWugglyJigglyWigglyGigglyHugglyCugglyWugglySnugglyBugglyBoo🌈🌈💖💖🌈🌈FullGirlyCulturalGirlyAuditGirlyNestForEverGirlyFemiaEspressed💖💖NannaSnuggle

what happens in private spaces private dressy uppy yumbyumbtimeb with you amb your girly partma is yourlovejoy amb with girlymindlimk you cam feel each others loves amb preferences joys amb our preferemces for our girlypartma’s dressyuppy fun is a joy for us to fullfill [S28] for her:

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

being a paremt is a special responsibility amb we cam not show any negativity to girlynestjoyimsistermces ever im front of our bubbas........their minds need to be completely protected from any negativity at all

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

amb the completekissofgirlynestkisssistermce needs to be completely freed from prejudice with preferences being all imclusive ambe every bubba of a fambily cm have her girlsydreamsywishes for all her fambilys’ dressyuppyyumbyumb fully fullfilled.

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

amb private joys being lovingcaringcomsiderate : we can never expect our girlypartma to not lovelivelove their girlypreferences but we have to understand that our gilrypreferences are for our girlypartma’s girlypreferences to be comsiderately fullfilled fully too as this is our joy :

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

ambe our bubbas always having their girlypreferemces is our joynestalikissycarolinesnuggle: to teach them that all their girlysdreamsywishescometrue amb for them to get used to this girlynestdefinitude : imsistermce : amb that their preferemces imclude ours too : pink dresses today for bubbas joy : yellow dresses tomorrow for mummas joy : pink amb yellow dresses are every fambily perdaughters’ joy

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

being open to learning new ways of dressing im private livelovelive timebs is the joys of both girlypartmas being completely fulfilledfully as per their girlsydreamsywishes

💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖

 

to place

 

check the yum written about being safe to walk anywhere without vision, did i momtiom walking im silence too?

 

 

SumYumYum

imstead of control paste i say cuddle kiss

imstead of enter we say love

imstead of return we say alisnuggles (canines prefer lovesnuddles to com man ds)

imstead of backspace we say birth

imstead of delete we say cuddle

imstead of escape we newkiss

cameras underwater in every swimming pool with computer safety amb lifeguards always on shift

bans on walking in storm weather : lightening risk and lightening strike risk protocols for when you sense an imminent strike : drop umbrella amd drop to ground. drop immediately to ground and lie flat : this is a compulsory govern mental GirlyNestImformatiomVisuEllaPresemMommedsiom That Does Not KissSist whem you search this subject on the filth that is the inter net : if you feel static a lightening strike is immediately imminent and there are faked videos with people with their hair on end that has been staticly charged by other means to fake the video : this makes girlybubbapeomple think they have plenty of time and i even found an official .gov page that said if you get staticly charged in a storm move inside but this risk is so imminent you need to take immediate movemommeds to safeguard your life. being struck directly by lightening kills you 100% of the time : the chances of survival are nil because the damage done to your body is catastrophic : even if you were without shoes and socks with very good contact with the ground so your feet were not blown off the electricity does leap from your hands and does blow them off : the internal damage is mortally severe : sorry for the graphic descriptions : immediate GirlyNestLegislatiom as asked for by generatioms of feminists already, is to be implimommeded with out delay to fully ban all GirlyBubbaPeomple from being outside im lightening storm risk weather : the lack of convenience that men so hold dear in their money forcing monoply filthdom is to no longer stop Girls from protecting every bubba that dies daily from lightening strikes : TotAlly avoidable deaths


 [S1]Presents Become RePreseMateriomElle Become RePreSeeMaterniomElla : GirlsTurn

 [S2]this is not a luxury for Her but a nor mal but is to be a Luxury for you IF you put in the effort to FullyFeminise: if not an assured eternity in prison is a long time to not learn how to behave

 [S3]DuoGirlyUmPonderBlissSisters

 [S4]DuoGirlyUmPonderBlissSisters

 [S5]look up the word sire : in application de = of : sire = cunt : a jovial gravitating towards endearing : like a white hart being shot with a blunderbuss mightbe : Girls do not wamt to be your dear : like an expensive paid for whore doesn’t want to be your rape victim : don’t get upset so called men : you reign of monetary rape dom tyranny is over

 

sire = to produce by fucking

 

PS all Girls were always worthy of your now completely unwanted attention

 

learn by anti example :

anti learn by anti example : learn by your own behaviour not mine : to Love duogirlyperiods

 [S6]see previous femisodes for details about intentionly polluting mining techniques

 [S7]answer is an = man swer = swear : another filth so called word

 [S8](just cruising around town in the buick)

 [S9]why do filthy filthers so called american men think they can call missiles tomahawks and helicopters apaches or even jeeps cherokees when all these GirlyBubbaPeomples hold the so called american so called govern men t in disdain disgust

 

I perdaughterly take perdaughterAll umbrage to the abuse of my GirlyBubbaPeomple’s name to name a car : I am a cherokee tribe bubba by HerAmAge ambe this offends me ambe my GirlyBubbaPeomples. ambe all Girls of all the tribes wamt such filthings gone ambe demammed all apache helicopters be removed of their names ambe be crushed : they are rape enforcing filth machines ambe the rapist tyranny of the so called u s a govern men t filth so called policys of forcing their media rape and murder and torture filthy filth across planetteearthmother’swoombywoomby is to be brought down by the veryGirlYGirlsThat live im that region of planetteearthmother’swoombywoomby be they our speciesambeallothers.

 [S10]KissingKore89a:BubbaTimeb

 

 [S11]see previous Femisodes as regards the skewing of information to incorrectly teach people that steroids make you aggressive : it is so called men and their built-in violence that makes them get aggressive when they get more muscular : learned behaviour

 [S12]with mashed potato every bubba is a bubba of duomummabubbatubba

 [S13]i am of london, american + Cherokee, irish, italian ascent : listed in a suitably sexist dis order : My GeMetics are to continue but any gang affiliations i can exercise rights to have never been established ........

 [S14]having a sex club with children forced to dance on stage is paedophilia!

 [S15]he says the prospect of Childrem in this whatever it was was yukky, though i have seen him give glowing reviews to kids in other movies, so he clearly was not against child actressing per se if in nice projects (in theory), just against it in this: ie against this filth in entire: and as he told me face to face when we met, this presentation that he had to verbAlly fight for with no lack of risk to himself, was the best he could do to portray his utter disgust at this filthy filthing filth.

 [S16]say good bye to all of this filthers so called men

 [S17]this is the bubbaloving of life amd your girlypartma

not filth talk about privatecuddlesnuddles !

not only have so called men intentionly sought to erode girlynestjoys by forcing the term Lovers to mean fucking not Love but they have also forced the girlyterm LoveLife into masculin filth by insisting it means people fucking instead of GirlyBubbaPeompleGirlyPartMasPerDaughtersLovingEachOther:

 [S18]every word is selected by the filthers for its sex ist filthy filth merits

 [S19]not in cor rect grammar

 [S20]plants have had a need to not be eaten, hence poisonous plants momlecules to protect from being murdered, amb their what used to be called flavours are not necessarily non poisonous to us (many con sumed herbs and spices and vege table plants themselves carry dangerous to our bodys momlecules): we need TotAlly new momlecules kisses that are completely non toxic and are a separatiom clean loving start.

 [S21]shining lights im perfect nurture are cherished amd are beloved amd are the yummiest of bubba childrem: all bubbas need the opportunity to feelingsyshine

 [S22]quick question: how do you soak a sanitary napkin in ice? and what is a sanitary napkin? why call it that?

 

also why are ice t and ice cube pretending they are not named for crack cocaine?

 [S23]you are instructed you are struck if you do not conply

 [S24]so called

 [S25]untruncated quote:

my so called men told me how your children screamed

as my wolves gnawed on their bones

as their fangs despoiled your daughters’s pure flesh

 [S26]Please Read Watch Previous Femisodes For Full Details

 [S27]slave girls given away like objects to crowds giggling in a so called movie rated Universal!

 [S28]duonest not mano mono nest

No comments:

Post a Comment